>sp|P02769|P02769_BOVIN Serum albumin OS=Bos taurus (Bovine) OX=9913 GN=ALB PE=1 SV=4
MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA
>sp|Q29443|Q29443_BOVIN Serotransferrin OS=Bos taurus (Bovine) OX=9913 GN=TF PE=2 SV=1
MRPAVRALLACAVLGLCLADPERTVRWCTISTHEANKCASFRENVLRILESGPFVSCVKKTSHMDCIKAISNNEADAVTLDGGLVYEAGLKPNNLKPVVAEFHGTKDNPQTHYYAVAVVKKDTDFKLNELRGKKSCHTGLGRSAGWNIPMAKLYKELPDPQESIQRAAANFFSASCVPCADQSSFPKLCQLCAGKGTDKCACSNHEPYFGYSGAFKCLMEGAGDVAFVKHSTVFDNLPNPEDRKNYELLCGDNTRKSVDDYQECYLAMVPSHAVVARTVGGKEDVIWELLNHAQEHFGKDKPDNFQLFQSPHGKDLLFKDSADGFLKIPSKMDFELYLGYEYVTALQNLRESKPPDSSKDECMVKWCAIGHQERTKCDRWSGFSGGAIECETAENTEECIAKIMKGEADAMSLDGGYLYIAGKCGLVPVLAENYKTEGESCKNTPEKGYLAVAVVKTSDANINWNNLKDKKSCHTAVDRTAGWNIPMGLLYSKINNCKFDEFFSAGCAPGSPRNSSLCALCIGSEKGTGKECVPNSNERYYGYTGAFRCLVEKGDVAFVKDQTVIQNTDGNNNEAWAKNLKKENFEVLCKDGTRKPVTDAENCHLARGPNHAVVSRKDKATCVEKILNKQQDDFGKSVTDCTSNFCLFQSNSKDLLFRDDTKCLASIAKKTYDSYLGDDYVRAMTNLRQCSTSKLLEACTFHKP
>sp|Q9TTE1|Q9TTE1_BOVIN Serpin A3-1 OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-1 PE=1 SV=3
MRAERTSFLLALGLLVAGIRSVHCLPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGISMERTILRIIVRVNRPFLIAIVLKDTQSIIFLGKVTNPSEA
>sp|Q3SZV7|Q3SZV7_BOVIN Hemopexin OS=Bos taurus (Bovine) OX=9913 GN=HPX PE=2 SV=1
MARALRVPVALWLLGLCWSLAKAHPLARAPELGHGVEGGNVAKPDPEVTERCSDGWGFDATTLDEHGNMLFLKGEFVWKGHAWARQLISERWKDAPSPVDAAFRYDRNSVLLIKGDKFWVYPPEKGEEYPKLLQEKFPGIPFPLDAAVECHRGECSHEGVFFFQGNHTWFWDFSTKTIKKRSWPAVGNCSSAIRWLNRYYCFRGNKFLRFDPVTGEVNSTYPRDVRDYFMSCPNRGHAHRNATQHMDKRCSPHLVLSALLSDNHSATYAFSENHYWRLDSSRDGWHSWRIEHLWPQGPSTVDAAFLWDKKLYLIQGTQVYIFLTRAGYTLVKDYPKQLEKEFGSPDGVCLHSVDAAFTCPGSSQLYIMAGQKLWRLDLNLGAQATWTELPWLHTKVDGALCTEKSLGPHSCSANGLGLYLVQGPNLYCYKDVEELSKTKDLPQAQRMNSLLGCAPHQHS
>sp|A2I7N0|A2I7N0_BOVIN Serpin A3-4 OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-4 PE=3 SV=1
MRAERLSPLLALGLLVAGIRSVHCLPENVVVKDRHRRVDGHTLASSNTDFAFSLYKQLALKDPNKNVMFSPLSVSMALAFLSLGARGPTLTEILEGLKFNPTEIQETQIHQGFQHLLQALNRPRNQLQLSVGNAMFVQEELKLLDKFIEDARVLYSSEAFPTNFRDPEAAKSLINDYVKNKTQGKIEELFKDLSPRTELVLVNYVYFKAQWKTRFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDKGKMQDLEAKLTPEMLTRWRNSLQPRRIHELYLPKFSIKSNYELNDTLSQMGIKKIFTDADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA
>sp|P17690|P17690_BOVIN Beta-2-glycoprotein 1 OS=Bos taurus (Bovine) OX=9913 GN=APOH PE=1 SV=4
MPPPALVLLLGFLCHVAIAGRTCPKPDELPFSTVVPLKRTYEPGEQIVFSCQPGYVSRGGIRRFTCPLTGLWPINTLKCMPRVCPFAGILENGTVRYTTFEYPNTISFSCHTGFYLKGASSAKCTEEGKWSPDLPVCAPITCPPPPIPKFASLSVYKPLAGNNSFYGSKAVFKCLPHHAMFGNDTVTCTEHGNWTQLPECREVRCPFPSRPDNGFVNHPANPVLYYKDTATFGCHETYSLDGPEEVECSKFGNWSAQPSCKASCKLSIKRATVIYEGERVAIQNKFKNGMLHGQKVSFFCKHKEKKCSYTEDAQCIDGTIEIPKCFKEHSSLAFWKTDASDVKPC
>sp|P00735|P00735_BOVIN Prothrombin OS=Bos taurus (Bovine) OX=9913 GN=F2 PE=1 SV=2
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERECLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGNVSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRREECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTSGSRCLAWSSEQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDLGDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
>sp|A2I7N2|A2I7N2_BOVIN Serpin A3-6 OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-6 PE=3 SV=1
MRTERVSPLLALGILVAGLCSRVHCLPENVTPEEQHKVTSVDGHSLASSNTDFAFSLYKQLALKDPNKNVIFSPLSVSIALAFLSLGAHGPTVTEILEGLKFNLTETPETEIHQGFQHLLQTFNQPSNQLQLSVGNAIFVQEELKLLDKFIEDARVLYSSEAFPTNFRDPEAAKSLINDYVKNKTQGKIEELFKDLSPRTELVLVNYVYFKAQWKTRFDPKHTEKTEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDKGKMQDLEAKLTPEMLTRWRNSLQPRRIHELYLPKFSIKSNYELNDTLSQMGIKKIFTDADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA
>sp|P50448|P50448_BOVIN Factor XIIa inhibitor OS=Bos taurus (Bovine) OX=9913 GN=- PE=1 SV=1
MASRLTPLTLLLLLLLAGDRVTSDMIVGPGNLQEGESEGDSQKGGILDGESIQGNEDSPTLPITNLTVVPATVTKPFSQPATEPVQSTIQPTAEPFCLAPVTSCSDSEIRSAEAVLGEALTDFSLRLYQDFSVLKKRETNFIFSPFSIASLLTQILLGAGGETRVSLEHLLSYPQNFSCVHHALRAFMSEGFTSFSQIFHSSDLTIKDTFAEASQRLYGSSPRPLGNDSTASLELINDWVAKKTNLRIRRLLDSLPEDTRLILLNAVALSAKWKIAFDKGRTSTKPFHLKSSAIKVPMMNSKKYPVASFTDRTLNRPGGRLQLSHNLSFVILVPQTVKHHLQDLEQALSTAVFKAVIKKLEMTKFHPTHLTMPRIKVQSSQDMLDYFDFIYDVNLCGLTEDPDVQVSGIRHQATLELTESGVDATAASVVSVARNLLLFEVQQPFLFLLWDQQHKFPVFMGRVYDPKG
>sp|A7E3W2|A7E3W2_BOVIN Galectin-3-binding protein OS=Bos taurus (Bovine) OX=9913 GN=LGALS3BP PE=1 SV=1
MAPLRLFWIWLLVVGTRGVKDGDMRLADGGSANQGRVEIYYNGQWGTVCENMWDLTDASVVCRALGFQNATEALGGAAFGPGYGPIMLDEVRCTGTEPSLANCSSLGWMRSNCRHDKDASVICTNETRGVYTLDLSGELPAALEQIFESQKGCDLFITVKVREEDEIAMCAHKLILSTNPEAHGLWKEPGSRVTMEVDAECVPVVKDFIRYLYSRRIDVSLSSVKCLHKLASAYQAKQLQSYCGHLFAILIPQDPSFWTPLELYAYALATRDPVLEEICVQFLAWNFGALTQAEAWPSVPPALLQGLLSRTELVVPSELVLLLAVDKWSQERRTSHKEVEALVGQVRFPMMPPQDLFSLQFNLSLYWSHEALFQKKILQALEFHTVPFELLAQYWGLNLTEGTYQPRLYTSPTWSQSVMSSSYNPSRSFQTPQHPSFLFHDSSVSWSFVYLPTLQSCWNYGFSCSSDDPPLLALSKSSYSKSNPTIGYENRALLHCEGSFVVDVIDFKGWKALVPSALATNSSRSTSLFPCPSGVFSRFQVVIRPFYLTNSTDMD
>sp|A2I7N3|A2I7N3_BOVIN Serpin A3-7 OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-7 PE=3 SV=1
MRTERTSFLLALGLLVSGFCSRVHCLPENVTPEEQHKGTSVDGHSLASSNTDFALSLYKQLALKDPNKNVIFSPLSISIALAFLSLGAHDHTVTEILEGLKFNLTETPETEIHQGFQHLLQTFNQPSNQLQLSVGNAMFASEELKLLDKFRKDAEAFYASEVLSTNFKDSEAAVKLINEYVKNKTHGKIEKLFNDLDVLTNLILLNYIFFKAQWKTPFNPNHTYESEFHVSQNERVIVPMMTLYLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMQDLEAKLTPETLTRWRSSLQPRLIHRLRLPRFSISSHYQLKDILSQLGIKKIFTSDAGFSGITDDHKLAVSHVIHKAVLDVGEEGTEGAAVTAVVMATSSLLHTLTVSFNRPFLLSIFCKETQSIIFWGKVTNPKEA
>sp|P51749|P51749_BOVIN CD40 ligand OS=Bos taurus (Bovine) OX=9913 GN=CD40LG PE=2 SV=1
MIETYSQPSPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNKGEGSLSLLNCEEIRSRFEDLVKDIMQNKEVKKKEKNFEMHKGDQEPQIAAHVISEASSKTTSVLQWAPKGYYTLSNNLVTLENGKQLAVKRQGFYYIYTQVTFCSNRETLSQAPFIASLCLKSPSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQSGASVFVNVTDPSQVSHGTGFTSFGLLKL
>sp|Q3Y5Z3|Q3Y5Z3_BOVIN Adiponectin OS=Bos taurus (Bovine) OX=9913 GN=ADIPOQ PE=1 SV=1
MLLQGALLLLLALPSHGEDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
>sp|P00745|P00745_BOVIN Vitamin K-dependent protein C OS=Bos taurus (Bovine) OX=9913 GN=PROC PE=1 SV=1
XTSLLLFVTIWGISSTPAPPDSVFSSSQRAHQVLRIRKRANSFLEELRPGNVERECSEEVCEFEEAREIFQNTEDTMAFWSFYSDGDQCEDRPSGSPCDLPCCGRGKCIDGLGGFRCDCAEGWEGRFCLHEVRFSNCSAENGGCAHYCMEEEGRRHCSCAPGYRLEDDHQLCVSKVTFPCGRLGKRMEKKRKTLKRDTNQVDQKDQLDPRIVDGQEAGWGESPWQAVLLDSKKKLVCGAVLIHVSWVLTVAHCLDSRKKLIVRLGEYDMRRWESWEVDLDIKEVIIHPNYTKSTSDNDIALLRLAKPATLSQTIVPICLPDSGLSERKLTQVGQETVVTGWGYRDETKRNRTFVLSFIKVPVVPYNACVHAMENKISENMLCAGILGDPRDACEGDSGGPMVTFFRGTWFLVGLVSWGEGCGRLYNYGVYTKVSRYLDWIYGHIKAQEAPLESQVP
>sp|Q2KIS7|Q2KIS7_BOVIN Tetranectin OS=Bos taurus (Bovine) OX=9913 GN=CLEC3B PE=2 SV=1
MELWGPCVLLCLFSLLTQVTAETPTPKAKKAANAKKDAVSPKMLEELKTQLDSLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFVQAKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGSEAEVWLGFNDMASEGSWVDMTGGHIAYKNWETEITAQPDGGKVENCATLSGAANGKWFDKRCRDKLPYVCQFAIV
>sp|F1N455|F1N455_BOVIN Pept_C1 domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=CTSC PE=3 SV=1
MGPWSGSRLVALLLLVYGAGSVRGDTPANCTYPDLLGTWVFQVGSSGSQRDVNCSVMGPPEKKVVVHLKKLDTAYDDFGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGGKVTSYCHETMTGWVHDVLGRNWACFTGRKTGNTSENVNVNTARLAGLEETYSNRLYRYNHDFVKAINAIQKSWTAAPYMEYETLTLKEMIRRGGGHSRRIPRPKPAPITAEIQKKILHLPTSWDWRNVHGINFVTPVRNQGSCGSCYSFASMGMMEARIRILTNNTQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEDCFPYTGTDSPCRLKEGCFRYYSSEYHYVGGFYGGCNEALMKLELVHQGPMAVAFEVYDDFLHYRKGVYHHTGLRDPFNPFELTNHAVLLVGYGTDAASGLDYWIVKNSWGTSWGENGYFRIRRGTDECAIESIALAATPIPKL
>sp|Q28107|Q28107_BOVIN Coagulation factor V OS=Bos taurus (Bovine) OX=9913 GN=F5 PE=1 SV=1
MFLACPGFWVLVVLGSSWAGWGNLGAEAAKLRQFYVAAQSIRWNYRPESTHLSSKPFETSFKKIVYREYEAYFQKEKPQSRTSGLLGPTLYAEVGDIMKVHFKNKAHKPLSIHAQGIKYSKFSEGASYSDHTLPMEKMDDAVAPGQEYTYEWIISEHSGPTHDDPPCLTHIYYSYVNLVEDFNSGLIGPLLICKKGTLTEDGTQKMFEKQHVLMFAVFDESKSWNQTSSLMYTVNGYVNGTMPDITVCAHDHISWHLIGMSSGPELFSIHFNGQVLEQNHHKISAITLVSATSTTANMTVSPEGRWTIASLIPRHFQAGMQAYIDIKNCAKKTRNPKKLTRDQRRHIKRWEYFIAAEEVIWDYAPIIPANMDKKYRSLHLDNFSNRIGKHYKKVVYKQYQDDSFTKRLEDPSSEGDGILGPIIRAQVRDTLKIVFKNMASRSYSIYPHGVTFSPYDNEVNSSSTSGSNTMIRAVRPGETYTYKWNILESDEPTENDAQCLTRPYYSNVDITRDLASGLIGLLLICKSRSLDRRGIQRAADIEQQAVFAVFDENKSWYIEDNIYKFCENPEKVKRDDPKFYESNIMSNFTLPAINGYVPESIPILGFCFDDTVQWHFCSVGTQNDILTIHFTGHSFIYGKRHEDTLTLFPMQGESVTVTMDNVGTWMLTTMNSNPRSKKLRLRFRDAKCIRNDDDDSYEIIYEPSGSTAMTTKKIHDSSEIEDENDADSDYQDELALILGLRSFRNSSLNQEKDELNLTALALEKDSEFIPPSANRSLDSNSSSRSHVSRLIAKNFAESLKTLLHLEAPAAGSPLEHAGLDKNSALNPPMAEHSSPYSEDPREDHPLSDVTGVSLLPFGTGFKNRKPAKHQRFQVGRGQAAKHKFSQTRFPAHKTRTRLSQDNSSSSRMGPWEDIPSDLLLLQQKDPYKILNGEWHLVSEKGSYEIIQDANENKTVNKLPNSPQNDSRTWGENIPFKNSHGKQSGHPTFLVTRRKPLQDRQDRRNSRLKEGLPLIRTRRKKKEEKPAYHVPLSPRSFHPLRGEVNASFSDRRHNHSLLLHASNETSLSIDLNQTFPSMNLSLAASLPDHDQTSPNDTTSQTSSPPDLYPTVSPEEHYQIFPIQDSDPTHSTTAPSNRSPDPTHSTTAPSNRSPPTQPSQIPNYDLRNRAIPTDVSQIFPSLELEVWQTATSLDLSQPSISPDLGQMALSPDPGQESLSPDLGQTSLSPDLSQESLSPDLGQTALSPDPSQESLSPDLGQTALSPDPSQESLSPDLGQTALSPDPGQESLSPDLGQTSLSPDLSQESLSPDLGQTALSPDPSQESLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLGQESLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLGQESLSPDLGQTALSPDLSQESLSPDLGQTPLSPDLSLESLSPDLSQLDLKQTSPPLDLNQTSHTSESSQSLPLPEFGQTFPNADIGQMPSPPPDSTLNNTFIPEEFNPLVVVGLSRDDGDYIEIIPRQKEESSEEDYGEFEFVAYNDPYQTDLRTDINSSRNPDNIAAWYLRSNTGNRKYYYIAAEEISWDYSKFVQSDDVDYVPEDTVYKKVVFRKYLDSTFTKLDPQGEYEEHLGILGPVIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEGKTYEDDSPEWFKEDNAIQPNKTYTYVWHATTRSGPENPGSACRAWAYYSAVNPEKDIHSGLIGPLLICRKGTLDKETNMPVDMREFVLLFMVFDEKKSWYYDKKPTRSWRRASSEVKNSHEFHAINGMIYNLPGLRMYEQEWVRLHLLNLGGSRDIHVVHFHGQTLLENGTQQHQLGVWPLLPGSFKTLEMKASKPGWWLLDTEVGEIQRAGMQTPFLIVDRECKMPMGLSTGLIADSQIQASEFWGYWEPKLARLNNGGSYNAWIAEKLSTEFNPEPWIQVDMQKEVLLTGIQTQGAKHYLKPYYTTEFCVAYSLDRKNWRIFKGNSTRNVMYFGGNSDASTIKENQIDPPVVARYIRISPTGSYNKPALRLELQGCEVNGCSTPLGMESGKIENKQITASSFKKSWWGNYWEPFLARLNAQGRVNAWQAKANNNNQWLQIDLLKIKKITAIVTQGCKSLSSEMYVKSYTIHYSDQGTDWKPYREKSSMVDKIFEGNNNVRGHVKNFFNPPIISRFIRIIPKTWNQSIALRLELFGCDMY
>sp|P24627|P24627_BOVIN Lactotransferrin OS=Bos taurus (Bovine) OX=9913 GN=LTF PE=1 SV=2
MKLFVPALLSLGALGLCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALECIRAIAEKKADAVTLDGGMVFEAGRDPYKLRPVAAEIYGTKESPQTHYYAVAVVKKGSNFQLDQLQGRKSCHTGLGRSAGWIIPMGILRPYLSWTESLEPLQGAVAKFFSASCVPCIDRQAYPNLCQLCKGEGENQCACSSREPYFGYSGAFKCLQDGAGDVAFVKETTVFENLPEKADRDQYELLCLNNSRAPVDAFKECHLAQVPSHAVVARSVDGKEDLIWKLLSKAQEKFGKNKSRSFQLFGSPPGQRDLLFKDSALGFLRIPSKVDSALYLGSRYLTTLKNLRETAEEVKARYTRVVWCAVGPEEQKKCQQWSQQSGQNVTCATASTTDDCIVLVLKGEADALNLDGGYIYTAGKCGLVPVLAENRKSSKHSSLDCVLRPTEGYLAVAVVKKANEGLTWNSLKDKKSCHTAVDRTAGWNIPMGLIVNQTGSCAFDEFFSQSCAPGADPKSRLCALCAGDDQGLDKCVPNSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLNREDFRLLCLDGTRKPVTEAQSCHLAVAPNHAVVSRSDRAAHVKQVLLHQQALFGKNGKNCPDKFCLFKSETKNLLFNDNTECLAKLGGRPTYEEYLGTEYVTAIANLKKCSTSPLLEACAFLTR
>sp|P01888|P01888_BOVIN Beta-2-microglobulin OS=Bos taurus (Bovine) OX=9913 GN=B2M PE=1 SV=2
MARFVALVLLGLLSLSGLDAIQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
>sp|Q03247|Q03247_BOVIN Apolipoprotein E OS=Bos taurus (Bovine) OX=9913 GN=APOE PE=1 SV=1
MKVLWVAVVVALLAGCQADMEGELGPEEPLTTQQPRGKDSQPWEQALGRFWDYLRWVQTLSDQVQEELLNTQVIQELTALMEETMKEVKAYKEELEGQLGPMAQETQARVSKELQAAQARLGSDMEDLRNRLAQYRSEVQAMLGQSTEELRARMASHLRKLPKRLLRDADDLKKRLAVYQAGASEGAERSLSAIRERFGPLVEQGQSRAATLSTLAGQPLLERAEAWRQKLHGRLEEVGVRAQDRLDKIRQQLEEVHAKVEEQGNQMRLQAEAFQARLRSWFEPLVEDMQRQWAGLVEKVQLALRPSPTSPPSENH
>sp|P18902|P18902_BOVIN Retinol-binding protein 4 OS=Bos taurus (Bovine) OX=9913 GN=RBP4 PE=1 SV=1
ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQKIVRQRQEELCLARQYRLIPHNGYCDGKSERNIL
>sp|Q3SWW8|Q3SWW8_BOVIN Thrombospondin-4 OS=Bos taurus (Bovine) OX=9913 GN=THBS4 PE=2 SV=1
MLAPRGATFLLLHLALQPWLGAGAQATPQVFDLLPSASQRLNPSVLQPILTDPTLNELYVISTFKLQSKSSATIFGLYSSADHSKYFEFTVMGRLNKAILRYLKNDGRIHLVVFNNLQLADGRRHRLLLRLTNLHRGAGSVELFLDCTRVDSIHNLPRAFSGLAQSPEAVELRTFQRKAHDSLEELKLVVRGSLIQVASLQDCFLQQSEPLATTNTGDFNRQFLGQMSQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLMPVVPAASPTPPVRRCDSNPCFRGVRCTDTRDGFQCGPCPEGYTGNGIVCSDVDECRYHPCYPGVRCVNLAPGFRCDACPVGFTGPMMQGVGISFAKTNKQVCTDIDECRNGACVLNSICINTLGSYRCGPCKPGYIGDQMRGCKMERNCRDPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDDDADGDGILNEQDNCVLTHNVDQRNSDKDIFGDACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCQKVPNSDQEDRDGDGVGDACDSCPEVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICEADFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDK
>sp|Q58CQ9|Q58CQ9_BOVIN Pantetheinase OS=Bos taurus (Bovine) OX=9913 GN=VNN1 PE=1 SV=1
MIMSQLLNYVAVLFFCVSRASSLDTFIAAVYEHAVILPNATLVPVSPEEALAVMNRNLDLLEGAVTSASKQGAHIIVTPEDGIYGFNFTRESIYPYLEDIPDPQVNWIPCNNPDRFGHTPVQQRLSCLAKDNSIYIVANIGDKKSCNASDPQCPPDGRYQYNTDVVFDSKGKLVARYHKQNLFLNEDQFNAPKEPEVVTFNTTFGKFGIFTCFDILFHDPAVTLVRDSHVDTILFPTAWMNVLPHLSAIEFHSAWAMGMRVNFLASNLHYPLKKMTGSGIYAPDSPRAFHYDMKTEEGKLLLAQLDSHPHPTPVVNWTSYASGVEAHSVGNQEFTGIIFFDEFTFLELKEIGGNYTVCQRDLCCHLSYKMSEKRSDEVYALGAFDGLHTVEGSYYLQICTLLKCKTTDLHTCGDSVETASTRFEMFSLSGTFGTQYVFPEVLLSEIQLAPGEFQVSNDGRLFSLKPTSGPVLTVTLFGRLYEKDSAPNTLSDLTTQALRLNPKTDAWKSK
>sp|Q58CS6|Q58CS6_BOVIN Intraflagellar transport protein 20 homolog OS=Bos taurus (Bovine) OX=9913 GN=IFT20 PE=2 SV=1
MTHLSLADPVREPLFSGEAGRQTAMAKDILAEAGLHFDELNKLRVLDPEVSQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
>sp|O62644|O62644_BOVIN Leukocyte cell-derived chemotaxin-2 OS=Bos taurus (Bovine) OX=9913 GN=LECT2 PE=1 SV=1
MFSTGTLLLAALISPALAGPWAIICAGKSSNEIRTCDGHGCGQYTAQRNQKLHQGVDVLCSDGSTVYAPFTGKIMGQEKPYKNKNAINNGVRISGGGFCIKMFYIKPIKYKGSIKKGEKLGTLLPLQKVYPGIQSHIHIENCDLSDPTVYL
>sp|P02676|P02676_BOVIN Fibrinogen beta chain OS=Bos taurus (Bovine) OX=9913 GN=FGB PE=1 SV=2
QFPTDYDEGQDDRPKVGLGARGHRPYDKKKEEAPSLRPVPPPISGGGYRARPATATVGQKKVERKPPDADGCLHADPDLGVLCPTGCKLQDTLVRQERPIRKSIEDLRNTVDSVSRTSSSTFQYITLLKNMWKGRQNQVQDNENVVNEYSSHLEKHQLYIDETVKNNIPTKLRVLRSILENLRSKIQKLESDVSTQMEYCRTPCTVTCNIPVVSGKECEKIIRNEGETSEMYLIQPEDSSKPYRVYCDMKTEKGGWTVIQNRQDGSVDFGRKWDPYKQGFGNIATNAEGKKYCGVPGEYWLGNDRISQLTNMGPTKLLIEMEDWKGDKVTALYEGFTVQNEANKYQLSVSKYKGTAGNALIEGASQLVGENRTMTIHNSMFFSTYDRDNDGWKTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGAYTWDMAKHGTDDGVVWMNWQGSWYSMKKMSMKIRPYFPEQ
>sp|Q2KJ39|Q2KJ39_BOVIN Reticulocalbin-3 OS=Bos taurus (Bovine) OX=9913 GN=RCN3 PE=2 SV=1
MMWPPSLLLLLLLLRRGAQGKPSPDAGPHGQGRVHHAAPLSEAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRSWIAHTQQRHIRDSVSAAWNTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYTAEPGEEEPAWVQTEREQFRDFRDLNKDGKLNGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL
>sp|F1MVS9|F1MVS9_BOVIN Mannan binding lectin serine peptidase 1 OS=Bos taurus (Bovine) OX=9913 GN=MASP1 PE=3 SV=1
MRWLLLSHALCFSLLKASAHIVELNNMFGQIQSPGYPDAYPSDSEVTWNITVPEGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSDEERFTGFDAHYVAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPSPYPKSSECLYTIELEEGFMISLQFEDIFDIEDHPEVSCPYDYIKIKAGPKVLGPFCGEKAPEPINTQSHSIQILFRSDNSGENRGWRLSYRATGNECPKLQPPVHGKIEPLQTTYSFKDQVLISCDTGYKVLKDNVEMDTFQMECLKDGTWSSKIPTCKIADCGAPAELENGVVTFSTRNNLTTYKSEIRYSCQRPYYKMLHNTTGVYTCSAQGVWMNEVLGRSQPTCLPVCGQPSRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWILTAAHVLRSQRRDNTVTPVSKEHVTVHLGLHDVRDKSGAVNSSAARVVLHPDFNIQSYNHDIALVQLREPVPLGPHILPVCLPPPEPAGPAPHVLGLVAGWGISNPNVTVDEIIGSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVILDDASQRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPQGLGELQVER
>sp|P12260|P12260_BOVIN Coagulation factor XIII A chain OS=Bos taurus (Bovine) OX=9913 GN=F13A1 PE=1 SV=2
MSESSGTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTNVHLFKERWDSNKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPTRDLFRVEYVIGLYPQENKGTYIPVPLVSELQSGKWGAKVVMREDRSVRLSVQSSADCIVGKFRMYVAVWTPYGVIRTSRNPETDTYILFNPWCEEDAVYLEN
>sp|A5PJI5|A5PJI5_BOVIN ATPase ASNA1 OS=Bos taurus (Bovine) OX=9913 GN=ASNA1 PE=2 SV=1
MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ
>sp|P49907|P49907_BOVIN Selenoprotein P OS=Bos taurus (Bovine) OX=9913 GN=SELENOP PE=2 SV=2
MWRGLGLALALCLLLTGGTESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLURKRCINQLLUQFPKDSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVIESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN
>sp|Q2KIA9|Q2KIA9_BOVIN Mitochondrial enolase superfamily member 1 OS=Bos taurus (Bovine) OX=9913 GN=ENOSF1 PE=2 SV=1
MVHGRVSRLSVHDVRFPTSLGGHGSDAMHTDPDYSAAYVVLETDAEDGLKGYGITFTLGRGTEVVVCAVNALAPHVLNKDLGEIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPLWKLLVDMDPRTLVSCIDFRYITDVLTEEEACEILRQSQVGKKEREEQMLAHGYPAYTTSCAWLGYPDATLKQLCSEALKDGWTRFKVKVGADLQDDIRRCRLVRNMIGPEKTLMMDANQRWDVPEAVEWMTKLAEFKPLWIEEPTSPDDILGHAAISKALAPLGIGVATGEQCHNRVIFKQLLQAKALKFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVGLCELVQHLIIFDFISVSASLQDRMCEYVDHLHEHFKYPVLIREAAYMPPKDAGYSTEMKEDSVKRHRYPDGEVWKKLLSAQGN
>sp|P00743|P00743_BOVIN Coagulation factor X OS=Bos taurus (Bovine) OX=9913 GN=F10 PE=1 SV=1
MAGLLHLVLLSTALGGLLRPAGSVFLPRDQAHRVLQRARRANSFLEEVKQGNLERECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTREICSLDNGGCDQFCREERSEVRCSCAHGYVLGDDSKSCVSTERFPCGKFTQGRSRRWAIHTSEDALDASELEHYDPADLSPTESSLDLLGLNRTEPSAGEDGSQVVRIVGGRDCAEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEQEEGNEMAHEVEMTVKHSRFVKETYDFDIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIVSGFGRTHEKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPNMFCAGYDTQPEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIDKIMKARAGAAGSRGHSEAPATWTVPPPLPL
>sp|A4IFM3|A4IFM3_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus (Bovine) OX=9913 GN=SDR9C7 PE=2 SV=1
MAAISDLSFMYRWFKNCNLVRNLSDKYVFITGCDSGFGNLLARQLVDRGMRVLAACFTKEGAQKLQQDTSYQLQTILLDVTKTESIKAATQWVRDQVGEQGLWALVNNAGVGLPSGPNEWLTKEDFVKVINVNLVGLIEVTLHMLPMVKKARGRVVNMSSSGGRVAVIGGGYCISKFGVEAFSDSIRRELHYFGVKVSIIEPGNFRTAILGKDGLEKHMRKLWERLPPETRESYGEEYFRIYTDNLKSTMQLADPRISEVTNSMEHAIVSRSPRIRYNPGLDAKLLYLPLAKFPTPVTDFILSRYLPRPADSV
>sp|E1BA60|E1BA60_BOVIN RAB32, member RAS oncogene family OS=Bos taurus (Bovine) OX=9913 GN=RAB32 PE=4 SV=1
MAGGGAGDPGRGAAAAAAPPETSEHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDISRGSTFDAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQKKDSGQTPSQMDQFCKEHGFTGWFETSAKDNVNIDEAARFLVENILANHQSFPNEENDGRIKLEEETVKKESKTQCC
>sp|E1BH39|E1BH39_BOVIN Katanin p60 ATPase-containing subunit A1 OS=Bos taurus (Bovine) OX=9913 GN=KATNA1 PE=3 SV=2
MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEINVEAKHVKDIMKTLESFKLDSTPLKAAQHELPASEGEVWSLPVPAERRPSPGPRKRQSSQYSDPKPQGNRPSTAVRVHRPSTHNLHNDRGKAVRSREKKEQNKGREEKNKSPAAATEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYSPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGASENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGADITNVCRDASLMAMRRRIEGLTPEEIRNLSREEMHMPTTMEDFEMALKKVSKSVSAADIERYEKWIFEFGSC
>sp|Q1RML9|Q1RML9_BOVIN Platelet-activating factor acetylhydrolase OS=Bos taurus (Bovine) OX=9913 GN=PLA2G7 PE=2 SV=1
MLPSKLHALFCLCTCLALVYPFDWQDLNPVAYIESPAWVSKIQALMAAANIGQSKIPRGNGSYSVGCTDLMFDYTNKGTFLRLYYPSQDDDHSDTLWIPNKEYFLGLSKFLGTHWLVGKIMGLFFGSMTTPAAWNAHLRTGEKYPLIIFSHGLGAFRTIYSAIGIDLASHGFIVAAVEHRDGSASSTYYFKDQSAVEIGNKSWLYLRTLKRGEEEFPLRNEQLRQRAKECSQALSLILDIDHGRPVMNVLDLEFDVEQLKDSIDRDKIAIIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPVGDEVYSRIPQPLFFINSERFQYPSNIIRMKKCFLPDRERKMITIRGSVHQNFVDFTFATSKIIGYLFTLKGDIDSNVAISLSNKASLAFLQKHLGLQKDFDQWDSLVEGEDHNLIPGTNINTTNHQATLQNSTGIERPNLD
>sp|P28801|P28801_BOVIN Glutathione S-transferase P OS=Bos taurus (Bovine) OX=9913 GN=GSTP1 PE=1 SV=2
MPPYTIVYFPVQGRCEAMRMLLADQGQSWKEEVVAMQSWLQGPLKASCLYGQLPKFQDGDLTLYQSNAILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKEDYVKALPQHLKPFETLLSQNKGGQAFIVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAYVARLNSRPKLKAFLASPEHMNRPINGNGKQ
>sp|Q5I597|Q5I597_BOVIN Betaine--homocysteine S-methyltransferase 1 OS=Bos taurus (Bovine) OX=9913 GN=BHMT PE=2 SV=1
MAPAGGKNVKKGILERLNSGEVIIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVAEKISGQKVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFQQQLEVFVKKNVDFLIAEYFEHVEEAVWAVEALKASGKPVAATMCIGPEGDLHSVTPGECAVRLVKAGASIVGVNCHFDPTISLQTVKLMKEGLEAAGLKAHLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPLASEKHGSWGSGLDMHTKPWIRARARKEYWENLQIASGRPYNPSMSKPDAWGVTKGTAELMQQKEATTEQQLRELFEKQKFKSAQ
>sp|E1B735|E1B735_BOVIN X-prolyl aminopeptidase 2 OS=Bos taurus (Bovine) OX=9913 GN=XPNPEP2 PE=3 SV=1
MAWARWGGHPWLVLLCAYAWGHPKSLDQREDVRNCSSSPPYLPVTAVNTTAQLTALRQQMYTQNLSAYIVPDTDAHMSEYIGEYDQRRAWITGFTGSAGVAVVTMEKASLWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPVGARVGVDPFLFSINSWESYDKALQDSDRELVSITVNLVDLVWGSERPPVPSEPIYALQEAFTGSTWQEKVAGIRSQMQKHHKAPTAVLLSALDETAWLFNLRGSDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLQYLNSSCTGPLCVQVEDYGQVRDSVQAYTSGDVKVWIGTSYTSYGLYEVIPKEKLLEDTYSPVMVTKAVKNSKEQTLLRASHVRDAVAVIRYLVWLEKNVPQGTVDEFSGAEQLEKFRGEEEFFSGSSFETISASGLNAALAHYSPTKELHRKLSSDEIYLVDSGGQYWDGTTDVTRTVHWGTPSAFQKEAYTRVLIGNIDLSRLVFPAATSGRMVEAFARKALWDVGLNYGHGTGHGIGNFLCVHEWPVGFQSSNIAMAKGMFTSIEPGYYLDGEFGIRLEDVALVVEAKTKYPGTYLTFEVVSLVPYDRNLIDVSLLSPEQLQYLNRYYQIIREKVGPELQRRQLQEEFSWLQWHTEPLTARAAPTASLAPLVTVSALAILGWSV
>sp|Q2YDI2|Q2YDI2_BOVIN Origin recognition complex subunit 4 OS=Bos taurus (Bovine) OX=9913 GN=ORC4 PE=2 SV=1
MSSRKSKSSNLIQADYISQVQRILRERFCHQSPHGNLFGVQVQYKHLIELLKRTAIHGESNSILIIGPRGSGKTMLINHALKELMEIEGVSENILQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLLDISQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLSLPSVFPEEIFAEKWNENVQSLSEDRSVKEVLQKHFNVSKNLRSLHMLLMLALNRVTPSHPFITAADLMEANQLCSMDSKGNIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL
>sp|G3MYD9|G3MYD9_BOVIN VWFA domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ITGAM PE=1 SV=1
MNHRILLLTALALCHGFNLDTEKAVIFQNNARGFGQSVVQIQGSRLVVGAPQEVKAANQTGGLYHCDYSTGRCEAIPLQVPPEAVNMSLGLSLAFAANPFRLLACGPTVHQICKENTYANGLCFSFGSNLLQQPRRIPRALRGCPEQDSDIAFLIDGSGSIDPVDFERMKRFVSTVMSQFQKSKTLFSLMQYSDDFQTHFTFNDFKRNPVPEFLVGPIRQLFGRTHTATGIRKVVRELFHSSSGARNHAIKIMIVITDGEKYLDPLEYSDVIPEADRKKIIRYVIGVGDAFRSRKSRQELDTIASKPPADHVFQVNNFEALKTIQNQLQEKIFAIEGTQTGSTSSFEHEMSQEGFSAAFTSDGPLLGAVGSFDWAGGAFLHTSNDKITFINTTRIDSDMNDAYLGYAAEVTLRNRVQHLFLGAPRYQHIGLVVIFRQNAGVWQKNAEIKGSQIGSYFGASLCSVDVNRDGSSDLVLIGAPHFYEQMRGGQVSMCPFPRGRAKWQCDAVLRGEPGHPWGRFGAALTALGDVNGDRLVDVAIGAPGEQENQGAVYLFHGTSKLGISPSHSQRITGSQISPKLQYFGQSLSGGQDLTMDGLVDLAVGAQGHVLLLRSQPVLKVEATMEFTPKEVKRNVYECRDPVVKGQIAGQVKVCLQVRKSTWDRLGEGDTQSTITYDLALDPGRPHSVAIFDETQNSTRRRVETLRLSQKCETLKLRLLDCVEDSVTPIALRLNFSLVGEPAHNYGGLRPVLAVDALRLFTASLPFEKNCGNDTVCQDDLSITFSFMDLDTLVVGGPRDLNVTVTVRNEGEDSYRTQVTFFYPSGLSYRRVSSSQNQRSQRFWRLTCESDVSTEGSGILKRTSCGINHPIFLDNSEITFNVTFDVNPDTYFGNKLLLKANVTSENNMPGNNKTQFQLELPVKYAVYMVVTSLEASTKYLNFTASEKTVHAMEHQYQFNNLGRKKLPISVVFWIPIRLNKVPVWSQPQVTFSQDVSSGCNTTEVAPRHSDFLAELKKSPVLNCSVAVCQRIQCAIPSFGIQEEFKVTLKSNFSFDWYIKTSHNHLQVVSKAEILFDESKFTLLPGQDAFVMAQTGTKVESYEVHNPIPLIVGSSVGGLVLLALISAGLYKLGFFKRQYKDMMTEPGPEVDTPQ
>sp|P22226|P22226_BOVIN Cathelicidin-1 OS=Bos taurus (Bovine) OX=9913 GN=CATHL1 PE=1 SV=2
METPRASLSLGRWSLWLLLLGLALPSASAQALSYREAVLRAVDQLNEQSSEPNIYRLLELDQPPQDDEDPDSPKRVSFRVKETVCSRTTQQPPEQCDFKENGLLKRCEGTVTLDQVRGNFDITCNNHQSIRITKQPWAPPQAARLCRIVVIRVCR
>sp|C1JZ66|C1JZ66_BOVIN Importin subunit alpha-8 OS=Bos taurus (Bovine) OX=9913 GN=KPNA7 PE=1 SV=2
MPTLDAPEERLRKFKYRGKDASARRQQRIAVSLELRKAKKDEQALKRRNITDVSLDPSDQQTKGVSLTLQEIISGVNASDPELCFQATQAARKMLSREKNPPLKLIVDAGLIPRLVELLKSSLHPRLQFEAAWALTNIASGASELTRAVVVGGAIQPLVELLSSPHMTVCEQAVWALGNIAGDGPEFRDNVIASDAIPHLLTLVSSSIPVPFLRNIAWTLSNLCRNKNPYPSDHAVKQMLPALFYLLGHPDREVLSDTCWALSYLTDGCDARIGQVVDTGVLPRLVELMSSSELNILTPSLRTVGNIVTGTDHQTQLALDAGILGVLPQLLTHPRPSIQKEAAWALSNVAAGPRQHIQRLIACGALPPLVAVLKNGEFKVQKEAVWTVANFTTGGSVEQLIQLVQAGVLEPLINLLTIPDNKMVIIILDVLFFILQAAEKISQKENMCLLIEGLGGLDRIEALQLHENHQVALTALNIIERHFSEEEETVTAFRARDQDHKFLKDLTNTYHCCTTPKPGPRP
>sp|P02666|P02666_BOVIN Beta-casein OS=Bos taurus (Bovine) OX=9913 GN=CSN2 PE=1 SV=2
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
>sp|P01030|P01030_BOVIN Complement C4 OS=Bos taurus (Bovine) OX=9913 GN=C4 PE=1 SV=2
NVNFQKAIHEKLGQYTSPVAKRCCQDGLTRLPMARTCEQRAARVQQPACREPFLSCCQFAESLRKKARTRGQVGLARVGFSVVPIAAAAVSLKVVARGSFDFPVGDAISKILQVEREGALHREEMVYELNPLDPLGRTLEIPGNSDPNIIPEGDFKSFVRVTASDPLEALGSEGALSPGGLASLLRLPQGCAEQTMTLLAPTLAASRYLDKTEQWSMLPPETKDRAVDLIQKGYTRIQEFRKRDGSYGAWLHRDSSTWLTAFVLKILSLAQDQVXGSAEKLQETATWLLSQQRDDGPFHDPCPVIHREMQGGLVGSDETVALTAFVVIALHHGLAVLPDKNSRVENSISRANTFLGAKATSGLLGSHASAITAYALSLTEAPEDLRRVAHNNLMAMAKDIGDKLYWGSVTTSPSNVLSPTPAPRSPADPIPQAPAMSIETTAYGLLHLLLWEGKAELADQAASWLTRQGSFQGGFRSTQDTVVALDALSAYWIASYTAEEKGLNVTLSSLGRSGLKSHVLQLTNHQVHRLEEELQFSLGSKINVEVRGNSKGTLKVLRSYNVMDMTNTTCQDLQIEVTVMGHVEYTMEAEEDYEDYEYEDLLAGDDPEAHSRXVTPLQLFDGRRNRRRREAPKAAEERESRVQYTVCIWRTGKVGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFGAVQEVPVGLVQPASAILYDYYNPEHKCSVFYGAPRKSKLLSTLCSADVCQCAEGKCPRQRRALERGQQDLEGYRMKFACYSPRVDYGFQVKVLREDSRAAFRLFETRITQVLHFTKDAGATADQTRNFLVRASCRLQLEPGKEYLIMGLDGATYDLKGDPQYLLDSNSWIEEMPSERMCQSTRHRTPCAQLNSFLQEYGTQXCQV
>sp|P60712|P60712_BOVIN Actin, cytoplasmic 1 OS=Bos taurus (Bovine) OX=9913 GN=ACTB PE=1 SV=1
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
>sp|G3MYZ3|G3MYZ3_BOVIN Afamin OS=Bos taurus (Bovine) OX=9913 GN=AFM PE=1 SV=1
MKQLKLTGFVIFFFFLTESLTLPTQPQDVDDVRITQKFIDDNIGYITIIAFAQYIQEASFEEVEMLVKAMTEYRDKCLADRTLPECSKLANEVLLENICAMEGLPQKYNFSHCCHKVDFERRLCFFHNKKADIGLLPPLPTLDPEEKCQTYKNNRESFLNNYVYEVSRRNPFVFAPTLLTVAARFEEMTKTCCEEQEKANCFQTKAEPFIYYLKALSSYQKNACRALMKFGRQILQSINIAILSQKFPKIGFKQLTSLLEDVSSKYDGCCEGDVVQCIRGRSKVMSHICSKQDSISSKIKDCCEKKIPERGECIIYSNKDDRPNDLSLREAKFIESDNVCEKRDADQANFMAEFLYEYSRRHPELSTPELLRIAKVYKDLLKECCNMENPPECYRHAENRFNETTEKSLKIVQRECEHFQNLGKDDLKYHYLINLTKLAPQLSTEELTFLGKEMVMALTTCCTLSEEFACVDNLVDLVLGELCGINENRNINPAVDHCCKTNFAFRRSCFESLEADKTYVPPSTSQGLFTFHADLCQAHNEELQRKKDRFLVNLVKLKPELAGEELWSLLADFTNVVEKCCKAQEPEACFKEESPKLAAKSQAA
>sp|Q3SZR3|Q3SZR3_BOVIN Alpha-1-acid glycoprotein OS=Bos taurus (Bovine) OX=9913 GN=ORM1 PE=2 SV=1
MALLWALAVLSHLPLLDAQSPECANLMTVAPITNATMDLLSGKWFYIGSAFRNPEYNKSARAIQAAFFYLEPRHAEDKLITREYQTIEDKCVYNCSFIKIYRQNGTLSKVESDREHFVDLLLSKHFRTFMLAASWNGTKNVGVSFYADKPEVTQEQKKEFLDVIKCIGIQESEIIYTDEKKDACGPLEKQHEEERKKETEAS
>sp|P34955|P34955_BOVIN Alpha-1-antiproteinase OS=Bos taurus (Bovine) OX=9913 GN=SERPINA1 PE=1 SV=1
MALSITRGLLLLAALCCLAPISLAGVLQGHAVQETDDTSHQEAACHKIAPNLANFAFSIYHHLAHQSNTSNIFFSPVSIASAFAMLSLGAKGNTHTEILKGLGFNLTELAEAEIHKGFQHLLHTLNQPNHQLQLTTGNGLFINESAKLVDTFLEDVKNLYHSEAFSINFRDAEEAKKKINDYVEKGSHGKIVELVKVLDPNTVFALVNYISFKGKWEKPFEMKHTTERDFHVDEQTTVKVPMMNRLGMFDLHYCDKLASWVLLLDYVGNVTACFILPDLGKLQQLEDKLNNELLAKFLEKKYASSANLHLPKLSISETYDLKSVLGDVGITEVFSDRADLSGITKEQPLKVSKALHKAALTIDEKGTEAVGSTFLEAIPMSLPPDVEFNRPFLCILYDRNTKSPLFVGKVVNPTQA
>sp|Q2KJF1|Q2KJF1_BOVIN Alpha-1B-glycoprotein OS=Bos taurus (Bovine) OX=9913 GN=A1BG PE=1 SV=1
MSAWAALLLLWGLSLSPVTEQATFFDPRPSLWAEAGSPLAPWADVTLTCQSPLPTQEFQLLKDGVGQEPVHLESPAHEHRFPLGPVTSTTRGLYRCSYKGNNDWISPSNLVEVTGAEPLPAPSISTSPVSWITPGLNTTLLCLSGLRGVTFLLRLEGEDQFLEVAEAPEATQATFPVHRAGNYSCSYRTHAAGTPSEPSATVTIEELDPPPAPTLTVDRESAKVLRPGSSASLTCVAPLSGVDFQLRRGAEEQLVPRASTSPDRVFFRLSALAAGDGSGYTCRYRLRSELAAWSRDSAPAELVLSDGTLPAPELSAEPAILSPTPGALVQLRCRAPRAGVRFALVRKDAGGRQVQRVLSPAGPEAQFELRGVSAVDSGNYSCVYVDTSPPFAGSKPSATLELRVDGPLPRPQLRALWTGALTPGRDAVLRCEAEVPDVSFLLLRAGEEEPLAVAWSTHGPADLVLTSVGPQHAGTYSCRYRTGGPRSLLSELSDPVELRVAGS
>sp|P28800|P28800_BOVIN Alpha-2-antiplasmin OS=Bos taurus (Bovine) OX=9913 GN=SERPINF2 PE=1 SV=2
MALLWGLLALILSCLSSLCSAQFSPVSTMEPLDLQLMDGQAQQKLPPLSLLKLDNQEPGGQIAPKKAPEDCKLSPTPEQTRRLARAMMTFTTDLFSLVAQSSTRPNLILSPLSVALALSHLALGAQNQTLQRLKEVLHADSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLEQSEQLFGAKPMSLTGMKGEDLANINRWVKEATEGKIEDFLSDLPDDTVLLLLNAIHFQGFWRSKFDPNLTQRGAFHLDEQFTVPVDMMQALTYPLHWFLLEQPEIQVAHFPFKNNMSFVVLMPTRFEWNASQVLANLTWDILHQPSLSERPTKVQLPKLHLKYQLDLVATLSQLGLQELFQAPDLRGISDERLVVSSVQHQSALELSEAGVQAAAATSTAMSRMSLSSFIVNRPFLFFILEDSTSLPLFVGSVRNPNPGAQPERKEQQDSPDGKDSFQDHKGLPRGDKPFDPDLKLGPPSEEDYAQPSSPK
>sp|P12763|P12763_BOVIN Alpha-2-HS-glycoprotein OS=Bos taurus (Bovine) OX=9913 GN=AHSG PE=1 SV=2
MKSFVLLFCLAQLWGCHSIPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTLNQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLKQDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYLQLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALGGEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAVPLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI
>sp|Q7SIH1|Q7SIH1_BOVIN Alpha-2-macroglobulin OS=Bos taurus (Bovine) OX=9913 GN=A2M PE=1 SV=2
MGKNKLLYPSLTLLLLLLLPTDASVSGKPQYMVLVPSLLHTETPEKGCLLLSHLNETVTVSASLESVRENRSLFTDVVAEKDLFHCVSFTLPRSPTSQEVMFLTIQVKGPTQEFKKRTTVLVKNEESLVFVQTDKPIYKPEQTVKFRIVLLDESFHPLNELVPLVYVEDPKGNRIAQWQNLEVENGLQQLTFPLSSEPFQGSYKVVVQKGSGGTAEHPFTVEEFVLPKFEVQVRMPKIITILEEEVQVSVCGLYTYGKPVPGRVTMNMCRKYRNPSNCYGEESNAVCEKFSGELNNEGCFSQQVNTKIFQLKRQEFEMKIEVEAKIQEEGTEVELTGKGATEITTTITKLSFVTVDSNLRRGIPFTGKVLLVDGKGVPMPNKVIFITANEANHNSNTTTDEHGLAQFSITTTKIKGTSLSIRVKYKDHSPCYGYQWLSEEHQDAYHSANLVFSRSNSFVYLEPLPRELPCGKTQTVQAHYVLKGQVLKDLKELVFYYLIMAKGGIVRSGTHTLPVEQGDMQGHFSMSVPVESDIAPVARLLIYAILPDGEVVGDSARYEIEHCLANKVGLNFSPGQSFPASQAHLRVTASPQSLCALRAVDQSVLLMRPEAELSAATVYNLLPVKDLSSFPSSVNQQEEDNEDCISHDNVYINGIMYFPVSNTNEKDMYSFLQDMGLKAFTNSKIHKPKICPQPEEHRIQHHTLLASPVRAEMGRNRDFVHFDDTSEPPTETVRKYFPETWIWDLVVVSSSGVHEVEVTVPDTITEWKAGALCLSRDTGLGLSPTASLRVFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPEKEQETYCICGNGRQTVSWAVTPKSLGNVNFTVSAEAVESQELCGSEVPVVPEHGRKDTIIKPLLVEPEGLEKEVIFNSLLCPSVDFVFLGAEDGGQVLRHFPPAAATDTAADAHDPARPGAKVSESLSLKLPPNVVEESARASFSVLGDILGSAMRNTQNLLQMPYGCGEQNMARFAPNIYVLDYLNETQQLTAELKSKAILYLNTGYQRQLLYKHFDGSYSTFGEHRGNSEGNTWLTAFVLKSFAQARGYIFIDEAHITEALTWLAQKQKSNGCFRSTGTLLNNAIKGGVDDEVTLSAYITIALLEMPLPVTHPVVRNALFCLDSAWKSAKEGSQGSHVYTKALLAYAFALAGNQERRTEVLTSLYEEAVKEDNTIHWTRPQKPRLLTEDIYQPRAPSAEVEMTAYVILAHVTAQPAPNPEDLKRATSIVKWISKQQNCQGGFSSTQDTVVALHALSRYGAATFTSARKAAQVTIQSSGTFSTKFQVENSNRLLLQQVSLPEVPGEYSMSVTGEGCVYLQTSLKYNILPKKDEFPFALEVQTLPQTCDGPKAHTSFQISLSVSYIGSRPASNMAIVDVKMVSGFIPLKPTVKMLERSNVSRTEVSNNHVLIYLDKVTNETLTLTFTVLQDIPVRDLKPAIVKVYDYYETDEFAVAEYSAPCSKDIGNA
>sp|F1MJQ3|F1MJQ3_BOVIN Alpha-amylase OS=Bos taurus (Bovine) OX=9913 GN=AMY2B PE=3 SV=1
MKFFLLLSVIVFCWAQYAPHTKTGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQISPPSENAVITDPSRPWWERYQPVSYKLCTRSGNESEFKDMVTRCNNVGVRIYVDAVINHMTGSGVSAGTSSTCGSYFNPGTRDFPAVPYSGWDFNDEKCNTGNGEIKSYDVAYQVRDCRLVGLLDLALAKDYVRSTVAEYLNRLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTSWFPEGSRPFIYQEVIDLGGETITSSDYFGNGRVTEFKYGVKLGTVLRKWSGEKMAYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMGVGFMLAHPYGFTRVMSSYHWPRHFEDGKDVNDWVGPPNNNGVIKEVTINPDTTCGNGWVCEHRWRQIRNMVIFRNVVDGQPFTNWWDNGSNQVAFGRGNKGFIVFNNDDWALSATLQTGLPPGTYCDVISGDKIGDNCTGIEINVSCDGNAYFSISNSAEDPFIAIHTESKL
>sp|Q3SZ57|Q3SZ57_BOVIN Alpha-fetoprotein OS=Bos taurus (Bovine) OX=9913 GN=AFP PE=2 SV=1
MKWVVSFFLLFLLNFSDSRTMHKNAYGIDSILDSSPCSSGTNLVGLATIFFAQSVQGATYEEVSQMVKDVLTIIEKPTGSKQPAGCLENQVSAFLEEICREKEIPEKYGLSDCCSRTGEERHDCFLAHKKAAPASIPPFPVLEPVTSCKSYKENRELFINRYIYEIARRHPVLYAPTILSVANQYNKIIPHCCKAENATECFETKVTSITKELRESSLLNQHICAVMGKFGPRTFRAITVTKVSQKFPKANFTEIQKLVMDVAHIHEECCKGNVLECLQDGERVMSYICSQQDILSRQIAECCKLPTTLELGHCIIHAENDDKPEGLSPNVNRFLGDRDFNQLSSRDKDLSMARFTYEYSRRHTKLAVPIILRVAKGYQELLEKCSQSENPSECQDKGEEELEKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSPELMALTRKMANAGAICCHLSEDKQLACGEGVADLIIGHLCIRHEENPINPGVDQCCTSSYSNRRPCFSSLVVDETYVPPPFSDDKFIFHKDLCQVQGVPLQTMKQQFLINLVKQKPQITEEQLETVVADFSGLLEKCCQSQEQEVCFTEEGPALISKTRAALGV
>sp|P15497|P15497_BOVIN Apolipoprotein A-I OS=Bos taurus (Bovine) OX=9913 GN=APOA1 PE=1 SV=3
MKAVVLTLAVLFLTGSQARHFWQQDDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
>sp|P81644|P81644_BOVIN Apolipoprotein A-II OS=Bos taurus (Bovine) OX=9913 GN=APOA2 PE=1 SV=2
MKLLALTVLLLTICGLEGALVRRQAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPATR
>sp|P19034|P19034_BOVIN Apolipoprotein C-II OS=Bos taurus (Bovine) OX=9913 GN=APOC2 PE=1 SV=2
MGTRYFLVGFLILLVLGFEVQGAHVPQQDEASSPALLTQVQESLLGYWDTAKAAAQKLYKKTYLPAVDEKIRDIYSKSTAAVTTYAGIITDQVFSVLSGKD
>sp|P19035|P19035_BOVIN Apolipoprotein C-III OS=Bos taurus (Bovine) OX=9913 GN=APOC3 PE=1 SV=2
MQPRLLLLAAFLALLVLPEATKAEEGSLLDKMQGYVKEATKTAKDALSSVQESQVAQQARDWMTESFSSLKDYWSSFKGKFTDFWESATSPTQSPP
>sp|Q28065|Q28065_BOVIN C4b-binding protein alpha chain OS=Bos taurus (Bovine) OX=9913 GN=C4BPA PE=2 SV=1
MKHQRVPVMILHSKGTMASWPFSRLWSISDPILFQVTLVATLLATVLGSCGIPPYLDFAFPINELNETRFETGTTLRYTCRPGYRISSRKNFLICDGTDNWKYKEFCVKKRCENPGELLNGQVIVKTDYSFGSEIEFSCSEGYVLIGSANSYCQLQDKGVVWSDPLPQCIIAKCEPPPTISNGRHNGGDEDFYTYGSSVTYSCDRDFSMLGKASISCRVENKTIGVWSPSPPSCKKVICVQPVVKDGKITSGFGPIYTYQQSIVYACNKGFRLEGDSLIHCEADNSWNPPPPTCELNGCLGLPHIPHALWERYDHQTQTEQQVYDIGFVLSYKCHFGYKPETDGPTTVTCQSNLEWSPYIECKEVCCPEPNLNNYGSITLHRRPSTSTHCTYISGDKISYECHSKYMFDALCTKHGTWSPRTPECRPDCKSPPVIAHGQHKVVSKFFTFDHQAVYECDKGYILVGAKELSCTSSGWSPAVPQCKALCLKPEIEYGRLSVEKVRYVEPEIITIQCESGYSVVGSENITCSEDRTWYPEVPKCEWEYPEGCEQVVTGRKLLQCLSRPEEVKLALEVYKLSLEIEILQTNKLKKEAFLLREREKNVTCDFNPE
>sp|Q2KIG3|Q2KIG3_BOVIN Carboxypeptidase B2 OS=Bos taurus (Bovine) OX=9913 GN=CPB2 PE=1 SV=1
MKLYSLGVLVATVLFCGEHAFAFQRGQVLSALPRTSRQVQILQNVTTTYKIVLWQPVAAEYIVKGYEVHFFVNASDVSNVKAHLNASRIPFRVLVENVEDLIRQQTSNDTISPRASSSYYEQYHSLNEIYSWIEVMTERYPDMVEKIHIGSSYEKYPLYVLKVSKKEQRAKNAMWIDCGIHAREWISPAFCLWFVGSVTYYYGKEKMHTNLLKHMDFYIMPVVNVDGYDYTWKKDRMWRKNRSLHEKNACVGTDLNRNFASKHWCGEGASSSSCSEIYCGTYPESEPEVKAVADFLRRNIKHIKAYISMHSYSQKIVFPYSYSRSRSKDHEELSLVAREAVFAMENIHRNIRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVVKNV
>sp|G5E5V0|G5E5V0_BOVIN Carboxypeptidase N catalytic chain OS=Bos taurus (Bovine) OX=9913 GN=CPN1 PE=4 SV=1
MSDLVSIFLHLLLFKLVAPVTFRHHRYDDLVRMLYKVHNECPHITRVYSIGRSVKGRHLYVLEFSDYPGIHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRIVRLVEDTRIHIMPSMNPDGYEVAAAAQERDISGYLVGRNNANGVDLNRNFPDLNTYIYYNEKNGGPNHHLPLPDNWKSQVEPETQAVIQWIRSFNFVLSANLHGGAVVANYPYDKSLGHRVRGFRRTANTPTPDDKLFQKLAKIYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPLQGELQREWLGNREALIQFLEQVHQGIKGMVRDENYNNLADAVISVGGINHDVTSGAHGDYFRLLLPGTYTVTATAPGFDPETVSVTVGPAEPKLVNFQLKRSTPQAAPKRRIPNSGHRGRVLPKKVQPRAARKKETMMKQPQRGPA
>sp|P17697|P17697_BOVIN Clusterin OS=Bos taurus (Bovine) OX=9913 GN=CLU PE=1 SV=1
MKTLLLLMGLLLSWESGWAISDKELQEMSTEGSKYVNKEIKNALKEVKQIKTQIEQTNEERKLLLSSLEEAKKKKEDALNDTRDSENKLKASQGVCNETMTALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGDRIDSLMENDREQSHVMDVMEDSFTRASSIMDELFQDRFFLRRPQDTQYYSPFSSFPRGSLFFNPKSRFARNVMPFPLLEPFNFHDVFQPFYDMIHQAQQAMDAHLQRTPYHFPTMEFTENNDRTVCKEIRHNSTGCLRMKDQCEKCQEILEVDCSASNPTQTLLRQQLNASLQLAEKFSRLYDQLLQSYQQKMLNTSALLKQLNEQFTWVSQLANLTQSDDQHYLQVFTVNSHNSDPSIPSGLTKVIVKLFNSFPITVTVPQEVSSPNFMENVAEKALQQYRRKSQEE
>sp|P02453|P02453_BOVIN Collagen alpha-1(I) chain OS=Bos taurus (Bovine) OX=9913 GN=COL1A1 PE=1 SV=3
MFSFVDLRLLLLLAATALLTHGQEEGQEEGQEEDIPPVTCVQNGLRYHDRDVWKPVPCQICVCDNGNVLCDDVICDELKDCPNAKVPTDECCPVCPEGQESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEGGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKGNSGEPGAPGSKGDTGAKGEPGPTGIQGPPGPAGEEGKRGARGEPGPAGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGAPGKDGVRGLTGPIGPPGPAGAPGDKGEAGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGSKGPRGETGPAGRPGEVGPPGPPGPAGEKGAPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPIGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDAGPAGPPGPPGPPGPPGPPSGGYDLSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKEKRHVWYGESMTGGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTYDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPACFL
>sp|E1BI98|E1BI98_BOVIN Collagen type VI alpha 1 chain OS=Bos taurus (Bovine) OX=9913 GN=COL6A1 PE=1 SV=1
MRLPRALLPLLLQACWASAQDDPVASRAIAFQDCPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNLNDRYYRCDRNLVWNAGALHYSDEVEIIRGLTRMPSGRDELKSSVDAVKYFGKGTYTDCAIKKGLEELLVGGSHLKENKYLVVVTDGHPLEGYKEPCGGLEDAVNEAKHLGIKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEVISQTIDTITDMIKNNVEQVCCSFECQPARGPPGPRGDPGYEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGMKGEKGSRGEKGSRGPKGYKGEKGKRGMDGVDGMKGETGFPGLPGCKGSPGFDGIQGPPGPKGDPGAFGLKGQKGEPGADGEPGRPGSTGPPGDEGEPGEPGPPGEKGEAGDEGNAGPDGAPGERGGPGERGPRGTPGARGPRGDPGEAGPQGDQGREGPVGVPGDPGEAGPIGPKGYRGDEGPPGTEGPKGAPGPAGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGSRGPPGINGTKGYPGLKGDEGEAGDPGEDNNDIAARGAKGAKGYRGPEGPQGPPGHVGPPGPDECEILDIIMKMCSCCECKCGPIDILFVLDSSESIGLQNFEIAKDFIVKVIDRLSKDELVKFEPGQSHAGVVQYSHNQMQEHVDLRDPNIRNAQDLKEAIKKLQWMGGGTFTGEALQYTRSRLLPPTPNNRIALVITDGRSDTQRDTTPLSVLCGPDIQVVSVGIKDVFGLAAGSDQLNVISCQGLAPQGRPGISLVKENYAELLDDGFLKNITAQICIDKKCPDYSCPITFSSPADITILLDGSASVGSHNFDITKRFAKRLAERFLTASRTDPGQDVRVAVVQYSGTGQQRPERAALQFLQNYTVLANTVDSMDFFNDATDVMDALGYVTRFYREASSNAAKKRLLLFSDGNSQGATPAAIEKAVQEAQRAGVEIFAVVVGRQVNEPHVRVLVTGKAAEYDVVFGERHLFRVPSYQALLRGVFYQTVSRKVALD
>sp|P42916|P42916_BOVIN Collectin-43 OS=Bos taurus (Bovine) OX=9913 GN=CL43 PE=1 SV=2
MLPLPLSILLLLTQSQSFLGEEMDVYSEKTLTDPCTLVVCAPPADSLRGHDGRDGKEGPQGEKGDPGPPGMPGPAGREGPSGRQGSMGPPGTPGPKGEPGPEGGVGAPGMPGSPGPAGLKGERGTPGPGGAIGPQGPSGAMGPPGLKGDRGDPGEKGARGETSVLEVDTLRQRMRNLEGEVQRLQNIVTQYRKAVLFPDGQAVGEKIFKTAGAVKSYSDAEQLCREAKGQLASPRSSAENEAVTQLVRAKNKHAYLSMNDISKEGKFTYPTGGSLDYSNWAPGEPNNRAKDEGPENCLEIYSDGNWNDIECREERLVICEF
>sp|Q0VCX1|Q0VCX1_BOVIN Complement C1s subcomponent OS=Bos taurus (Bovine) OX=9913 GN=C1S PE=2 SV=2
MWCIVLFSLVAWVYAEPTMYGEILSPNYPQVYPNEVEKSWDIEVPAGYGIHLYFTHLDIELSENCSYDSVQIMSGGHEEGKLCGRRTNKNSNSPVVKEFHIPYSKLQVIFRSDFSNEERFTGFAAYYVAEDIDECTAFADAPCSHFCNNFLGGYFCSCPPEYFLHEDKKNCGVNCSGNVFTTMTGEVESPNYPSPYPESSRCDYQIQLEEGFRVVVTMRREDFDVEPADSEGHCPDSLLFVAGDQHFGPYCGNGFPGPLTIETQSSALNIIFQTDGSEQRKGWKFRYHGDPIPCPKEVTANSFWEPERAKYVFRDVVKITCVDGFEVVQGSVGSPSFYSTCQSNGKWSNSKLRCQPVDCGAPEPIQHGRVEDPESTLFGSITRYSCEMPYYSMECEGSEVYHCSGNGSWVNKVLGIEPPKCIAVCGTPSEPFRSTQRIFGGSIAKIENFPWQVFFSNPWAGGALIDEYWVLTAAHVVEGNDIPVMYVGSSSVVTSQLSNAQMLTAERVFIHPGWEVLDPSITRKNFDNDIALVRLRDPVKMGPKVAPICLPGTSSEYDPPENVLGLISGWGRTNVKSHVIKLRGAKLPVAPLSKCREMKGVNPGIDISSFVFTENMICAGNDKGVDSCDGDSGGAFAVQDPKENKPKFYVAGLVSWGPQCGTYGIYTRVKNYVDWIRKTMQEYSAPSVD
>sp|Q2UVX4|Q2UVX4_BOVIN Complement C3 OS=Bos taurus (Bovine) OX=9913 GN=C3 PE=1 SV=2
MKPTSGPSLLLLLLASLPMALGNPMYSMITPNILRLESEETVVLEAHGGQGTIQVSVTVHDFPAKKQVLSNENTQLNSNNGYLSTVTIKIPASKELKSDKGHKFVTVVATFGNVQVEKVVLISLQSGYLFIQTDKTIYTPGSTVLYRVFTVDHKLLPVGQTVFITIETPDGIPVKRDSKSSQNQFGILTLSWNIPELVNMGVWKIKAYYEDSPQQVFSAEFEVKEYVLPSFEVQLEPEEKFYYIDDPDGLKVNIIARFLYGEQVDGTAFVIFGVQDGDRRISLTHSLTRVPINDGNGEAILKRQVLLNGVQPSRADALVGKSIYVSATVILQSGSDMVEAERTGIPIVTSPYQIHFTKTPKFFKPAMPFDLMVYVTNPDGSPARHIPVVTQGSNVQSLTQDDGVAKLSINTQNKRDPLTITVRTKKDNIPEGRQATRTMQALPYNTQGNSNNYLHLSVPRVELKPGETLNVNFHLRTDPGEQAKIRYYTYMIMNKGKLLKVGRQYREPGQDLVVLPLTITSDFIPSFRLVAYYTLINAKGQREVVADSVWVDVKDSCMGTLVVKNGGKEEKHHRPGQQITLKIEADQGARVGLVAVDKGVFVLNKKNKLTQRKIWDVVEKADIGCTPGSGRNYAGVFTDAGLTLKTSQGLETQQRADPQCPQPATRRRRSVQLMEKRMDKAGQYSSDLRKCCEDGMRDNPMKFPCQRRAQFILQGDACVKAFLDCCEYITQLRQQHSRDGALELARSDLDDDIIPEEDIISRSQFPESWLWTVIEDLKQADKNGISTKLMNVFLKDSITTWEILAVSLSDKKGICVADPYEVTVMQDFFIDLRLPYSVVRNEQVEIRAILYNYREAENLKVRVELLYNPAFCSLATAKKRHQQTITIPARSSVAVPYVIVPLKIGLHEVEVKAAVYNHFISDGVKKTLKVVPEGVRVNKTVAVRTLNPEHLGQGGVQREEVPAADLSDQVPDTESETKILLQGTPVAQMTEDAIDGERLKHLIQTPSGCGEQNMIGMTPTVIAVHYLDSTDQWEKFGLEKRQESLELIRKGYTQQLAFRQKSSAYAAFQYRPPSTWLTAYVVKVFALAANLIAIDSKDLCETVKWLILEKQKPDGIFQEDGPVIHQEMIGGFRDTREKDVSLTAFVLIALHEAKDICEAQVNSLGRSIAKAGDFLENHYRELRRPYTVAIAAYALALLGKLEGDRLTKFLNTAKEKNRWEEPNQKLYNVEATSYALLALLARKDYDTTPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDVPDHKELNLDVSIQLPSRNSAVRHRILWESASLLRSEETKENERFTVKAEGKGQGTLSVVTVYHAKLKGKVSCKKFDLRVSIRPAPETVKKPQDAKGSMILDICTKYLGDQDATMSILDISMMTGFSPDVEDLKTLSTGVDRYISKYEMNRDSNKNTLIIYLDKVSHTVEDCLSFKVHQYFNVGLIQPGAVKVYSYYNLDETCIRFYHPDKEDGMLSKLCHKDTCRCAEENCFMHHTEKEVTLEDRLDKACEPGVDYVYKTRLIQKKLEDDFDEYIMVIENIIKSGSDEVQVKQERKFISHIKCREALKLKEGAHYLVWGVSSDLWGEKPKISYIIGKDTWVELWPEAEECQDEENQKQCEDLANFTENMVVFGCPN
>sp|Q3MHN2|Q3MHN2_BOVIN Complement component C9 OS=Bos taurus (Bovine) OX=9913 GN=C9 PE=2 SV=1
MSAGQRFAFAICILEISLLRAGPTPSYDPAERQGTPLPIDCRMSSWSEWSKCDPCLKQMFRSRSIEIFGQFNGRKCVDAVGDRQQCVPTEACEDPEEGCGNDFQCGTGRCIKNRLLCNEDNDCGDYSDEDNCEQDPRPPCRNRVVEESELARTAGFGINILGMDPLSTPFDNQYYNGLCDRVWDGNTLTYYRRPWNVASLTYDTKADKNFRTENHEESIQILRTIIEEKKLNFNAGLSVKYTPVEAIEKNKCVDLEHSDKGSTSSPSKLAAEAKFRFTYSKDDIYRLLSSYSAKQEKMFLHVKGKVHLGRFVMRSRDVMLQTTFLDSINTLPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKKSMEQKDIELRDVQRCLGFDLDLSLKVGVEVTGNFDSKLCSKKGMGQTETNPEADLFDDVITFIRGGTRKYATELKEKLLRGARMINVTDFVNWAASLNHAPVLISQKLVPIYDLIPVKMKDAHLKKQNLERAIEDYINEFSVRKCQPCQNGGTVVLLDGECVCSCPKEFKGVACEIKK
>sp|P81187|P81187_BOVIN Complement factor B OS=Bos taurus (Bovine) OX=9913 GN=CFB PE=1 SV=2
MGIGHNPRLCLVPLILGLLCGGVGMTPLPEAGPQSPCSLEGVEIKGGSFRLLKAGQVLEYLCPSGFYPYPTQIRTCRSTGSWSTLQTQDRKIVKRAECKAIRCPRPQDFENGEYWPRAAYYNLSDEISFRCYDGYTLRGSANRTCQGNGRWDGETAICDDGATYCPNPGIPLGTRKVGSQYRLEDRVTYYCNRGLTLRGSEQRTCLEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTETIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSVGAHNFTGAKNCLRDFIEKVASYGVKPKYGLVTYATEPKVLIRVSDPKSSEADWVTDQLNQINYADHKLKAGTNTKRALLEVYNMMSREVNQFKETWNRTRHVIIIMTDGLHNMGGDPVTVIHDIRYLLDIGRNRKNPREDYLDIYVFGVGPLVNQENINALASKKDKEKHVFKLQGMENLEDVFVQMLDESRTLGLCGMVWEHKDGTAYHKQPWQAKISVTRPSKGHESCMGAIVSEYFVLTAAHCFTVDDEKHSIKVSLGGQRKEWEVKEILFHPKYDLNAKKAKGIPEFYDYDVALVRLKEKLKYETTIRPICLPCTEGSIQALRLPRSTTCQQQMQELLPAKDIEALFVSESKKTLTRKAVYIKNGDKKASCERDALRAPGYEKVKDVSEVVTPRFLCTGGVDPYADPNTCKGDSGGPLIIHKRSRFIQVGVISWGVVDVCKRPQQVPGYARDFHINLYQVLPWLKEKLQNEDLGFL
>sp|Q28085|Q28085_BOVIN Complement factor H OS=Bos taurus (Bovine) OX=9913 GN=CFH PE=1 SV=3
MRFPAKIVWLVLWTVCVAEDCKEPPPRKETEILSGSWTEQTYQEGTQATYKCRPGYRTLGSIVMMCRGGKWVSLHPSRICRKKPCAHPGDTPFGSFHLAEGTQFEYGAKVVYTCDEGYQMVGEMNFRECDTNGWTNDIPICEVVKCLPVTEPENGKIFSDALEPDQEYTYGQVVQFECNSGYMLDGPKQIHCSAGGVWSAETPKCVEIFCKTPVILNGQAVLPKATYKANERVQYRCAAGFEYGQRGDTICTKSGWTPAPTCIEITCDPPRIPNGVYRPELSKYRGQDKITYECKKGFFPEIRGTDATCTRDGWVPVPRCAWKPCSYPVIKHGRLYYSYRGYFPARVNQQFVYSCDHHFVPPSQRSWDHLTCTAEGWSPEEPCLRQCIFNYLENGHTPYREEKYLQGETVRVRCYEGYSLQNDQNTMTCTESGWSPPPRCIRVKTCSKSNIRIENGFLSESTFTYPLNKQTEYKCKPGYVTADGKTSGLITCLKNGWSAQPVCIKSCDRPVFEKARVKSDGTWFRLNDRLDYECVDGYENRDGRTTGSIVCGQDGWSDKAACYERECSIPEMDPYLNAYPRKETYKVGDVLKFSCSQGRIMVGADSVQCYHFGWSPKLPTCKVKKVKSCALPPELPNGKRKEIHKEEYAHNEVVEYACNPRFLMKGSHKIQCVDGEWTALPVCIEEERTCGNIPDLDHGDVKPSVPPYHHGDSVEFSCREAFTMIGPRFITCISGEWTQPPQCIATDELRKCKGSTLFPPEGRQAHKIEYDHNTNKSYQCRGKSEHKHSICINGEWDPKVDCNEEAKIQLCPPPPQVPNACDMTTTVNYQDGEKISILCKENYLIQDAEEIVCKDGRWQSIPRCIEKIGCSQPPQIDHGTISSSSSAEERREIHEQRLYAHGTKLSYTCEEGFEISENNVIICHMGKWSSPPQCVGLPCGLPPYVQNGVVSHKKDRYQYGEEVTYDCDEGFGTDGPASIRCLGGEWSRPQDCISTNCVNLPTFEDAVLTDREKDFYRSGEQVAFKCLSYYQLDGSNTIQCIKSKWIGRPACRDVSCGNPPQVENAIIHNQKSKYQSEERARYECIGNYDLFGEMEVVCLNGTWTEPPQCKDSQGKCGPPPPIDNGDITSLLQSVYPPGMIVEYRCQAYYELRGNKNVVCRNGEWSQLPKCLEACVISEETMRKHHIQLRWKHDKKIYSKTEDTIEFMCQHGYRQLTPKHTFRATCREGKVVYPRCG
>sp|E1BF81|E1BF81_BOVIN Corticosteroid-binding globulin OS=Bos taurus (Bovine) OX=9913 GN=SERPINA6 PE=3 SV=1
MLPTLYTCLLWLSTSGLWTVQAKGSDTDMSTRNPHRDLAPNNVDFAFTLYKHLVASAPGKNVFISPVSISTALAMLSLGARGYTREQLLQGLGFNLTEMSEGEIHRAFRHLHHLLRESNTTLDMTMGNALFLDHSLELLESFSADTKHYYELEALTTDFQDWAGASRQINEYIKNKTQGNIVDLFSESDSSATLILVNYIFFKGMWAHSFDLESTREENFHVNEATTVQVPMMFQSNTIKYLNDSVLPCQLVQLDYTGNETVFFVLPVKGKMDSVITALSRDTIQRWSKSLTMSQVDLYIPKISISGAYDLGGIMGDMGIADLLSNRTHFSGITQEALPKVSKVVHKAALQVDEKGLEADAPTRVSLSAAPGPLTLRFNRPFIIMIFDDFTWSSLFLGKVVNPT
>sp|A6QP30|A6QP30_BOVIN CPN2 protein OS=Bos taurus (Bovine) OX=9913 GN=CPN2 PE=2 SV=1
MLPGAWLCWACLLLLARPTLPCPQGCDCFIREVFCSDEGLAAVPLDIPPHATDIIFVETSFTVVGSRAFSSSPNLTKVVFLNTRVCHFRPDAFGGLPGLQDLEITGGNFSNFSADIFSNLISLSKFTLNFNMLEALPEGLFQHMDGLESLQLQGNRLQTLPQRLFQPLRCLKTLNLAQNLLAYLPEELFHPLGRLQTLRLSNNQLASLPRGLFSRLGSLQELFLDGNSISELPPEVFAQLSCLEKLWLQHNAIGHLPGSVFSALPNLTFLSLQGNALQTLPAGLFTQSPGLVSLSLSHNQLETVPEAAFANLTSLGSLMLSHNALTHLPAGVFRGLKGLVKLYLSSNNLTVLHPALFQNLSKLELLSLSRNLLTTLPEGIFDTNDNLFNLALYGNPWQCDCHLAYLFSWLYQYSDRLFNIQTYCAGPAYLKGQVVPALKEEQLVCPITRDHLGFQAAPGPQDREPGGAWDLVAEERAARSRCTYSNPEGTVVLACDKARCRWLNVQLSPRQGSGSPGLPINASQEWDLKSSCGSVRVTVSIEALAGEP
>sp|P01035|P01035_BOVIN Cystatin-C OS=Bos taurus (Bovine) OX=9913 GN=CST3 PE=1 SV=2
MVGSPRAPLLLLASLIVALALALAVSPAAAQGPRKGRLLGGLMEADVNEEGVQEALSFAVSEFNKRSNDAYQSRVVRVVRARKQVVSGMNYFLDVELGRTTCTKSQANLDSCPFHNQPHLKREKLCSFQVYVVPWMNTINLVKFSCQD
>sp|Q58D62|Q58D62_BOVIN Fetuin-B OS=Bos taurus (Bovine) OX=9913 GN=FETUB PE=1 SV=1
MNVLLLLVLCTLAMGCGATSPPQPAARPSSLLSLDCNSSYVLDIANDILQDINRDRKDGYVLSLNRVSDAREHRQEAGLGSLFYFTLDVLETGCHVLSRTSWKNCEVRIFHESVYGQCKAIFYINKEKRIFYLPAYNCTLRPVSQSAIIMTCPDCPSTSPYDLSNPRFMETATESLAKYNSESPSKQYSLVKITKTSSQWVFGPAYFVEYLIKESPCVKSEGSSCALESPGSVPVGICHGSLGEPQGNQGKIISVTCSFFNSQAPTPRGENATVNQRPANPSKTEELQQQNTAPTNSPTKAVPKGSVQYLPDWDKKREGSQEKDPVETFPVQLDLTTNPQGESLDVSFLFQEPMEEKVVVLPFPSKEQRSAECPGPAQKGYPFILPS
>sp|Q76LV2|Q76LV2_BOVIN Heat shock protein HSP 90-alpha OS=Bos taurus (Bovine) OX=9913 GN=HSP90AA1 PE=1 SV=3
MPEETQAQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSAAVTEEMPPLEGDDDTSRMEEVD
>sp|P02081|P02081_BOVIN Hemoglobin fetal subunit beta OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000038748 PE=1 SV=1
MLSAEEKAAVTSLFAKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSSADAILGNPKVKAHGKKVLDSFCEGLKQLDDLKGAFASLSELHCDKLHVDPENFRLLGNVLVVVLARRFGSEFSPELQASFQKVVTGVANALAHRYH
>sp|P01966|P01966_BOVIN Hemoglobin subunit alpha OS=Bos taurus (Bovine) OX=9913 GN=HBA PE=1 SV=2
MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
>sp|P02070|P02070_BOVIN Hemoglobin subunit beta OS=Bos taurus (Bovine) OX=9913 GN=HBB PE=1 SV=1
MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH
>sp|Q5E9Z2|Q5E9Z2_BOVIN Hyaluronan-binding protein 2 OS=Bos taurus (Bovine) OX=9913 GN=HABP2 PE=2 SV=1
MFARMSDLHVLLLMVLAGKTAFGLSLLSFLTEPDPDWTPDQYEYSQEYNNQEENASSTTAYSDNPDWYYEEDDPCLSNPCTHGGDCLVSGATFTCRCPDPFSGNRCQNVQNKCKNNPCGRGDCLITQSPPYHRCACKHPYRGSDCSRVVPVCRPNPCQNGGTCSRQRRRSKFTCACPDQFKGKLCEIGPDDCYVDDGYSYRGRVSKTIHQHTCLYWNSHLLLQEKYNMFMEDAEAHGIGEHNFCRNPDGDKKPWCFIKVNNVKVKWEYCDVPACSALDVANPEGRPTEPLTKFPEFGSCGRTEIAEKKVKRIFGGFKSTAGKHPWQASLQTSLRLTVSTPQGHYCGGALIHPCWVLTAAHCTEIKTKYLKVVLGDQDLTKTEFHEQSFGVQKIFKYSHYIEIDDIPYNDIALLKLKPVDGHCALESKYVKTVCLPDGPFLSGTECYISGWGVTETGEGSRHLLDAKVKLISNTICNSRQLYDHSIDDNMICAGNLQKPGQDSCQGDSGGPLTCEKDGTSYIYGIVSWGLECGKRPGVYTQVTKFLTWIKATMEKEASF
>sp|P56652|P56652_BOVIN Inter-alpha-trypsin inhibitor heavy chain H3 OS=Bos taurus (Bovine) OX=9913 GN=ITIH3 PE=1 SV=2
MALAQWPYLILALLSGLAVSGFPRNPSLLLGKRSLPGRAVDGIEVYSTKVNCKVTSRFAHNVVTTRAVNHANTAKEVSFDVELPKTAFITNFTLTIDGVTYPGKVKEKEVAKKQYEKAVSQGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVKHFEITVDIFEPQGISTLDAEASFITNDLLGSALTKSFSGKKGHVSFKPSLDQQRSCPTCTDSLLKGDFIITYDVNRESPANVQIVNGYFVHFFAPQGLPVVPKSVVFVIDVSGSMHGRKMEQTKDALLKILEDVKQDDYLNFILFSGDVTTWKDSLVPATPENIQEASKFVMDIQDRGMTNINDALLRGISMLNKAREEHTVPERSTSIIIMLTDGDANVGESRPEKIQENVRNAIGGKFPLYNLGFGNNLNYNFLENMALENHGLARRIYEDSDANLQLQGFYEEVANPLLTGVEVEYPQNAILDLTQNSYQHFYDGSEIVVAGRLADEDMNSFKAAVKGHGAINDLTFTEEVDMKEMEKALQERDYIFGDYIERLWAYLTIEQLLDKRKNAQGEEKEILTAQALELSLKYHFVTPLTSMVVTKPEDNENQTAIANKPGEGPLDAEEVPSMAYLTSYQAPQTPYYYVDGDPHFIIQIPEKDDAICFNIDEDPGTVLRLIQDPVTGLTVNGQIIGEKTGRSDSQTRRTYFGKLGIASAQMDFRIEVTRENITLWNGDSLSTFSWLDTVMVTQDGLSVMINRKKNMVVSFGDGVTFVVVLHQVWKKEPAHHDFLGFYVVNSRGMSAQTHGLLGQFFHPFDFQVSDVHPGSDPTKPDATMVVKNHQLTVTRGSQKDYRKDISVGRNVACWFVHNNGQGLIDGIHRDYIVPNLF
>sp|Q3T052|Q3T052_BOVIN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Bos taurus (Bovine) OX=9913 GN=ITIH4 PE=1 SV=1
MKTPAPGRIHSIVLVLLSLAVLQTSKAQKVQNDIDIYSLTVDSKVSSRFAHTVITSRVVNKADAVREATFQMELPKKAFITNFSMVIDGVTYPGNIKEKAAAQEQYSAAVARGESAGLVRATGRKTEQFQVSVSVAPAAKVTFELVYEELLARHLGAYELLLKVRPQQLVKHLQMDIHIFEPQGISFLETESTFMTNKLAEALTTSQNKTKAHVRFKPTLSQQQKYPEKQDTVIDGSFIVRYDVDRPLSGGSIQIENGYFVHYFAPDSLSTIPKNVIFVIDKSGSMMGRKIKQTREALIKILDDLSPHDQFDLISFSSEATTWKPLLVPASTENVNEAKSYATGIQAQGGTNINDAMLMAVQLLEKANQEELLPEGSITLIILLTDGDPTVGETNPLNIQKNVRKAINGQHSLFCLGFGFDVSYAFLEKMALENGGLARRIYEDSDSALQLQDFYQEVANPLMTSVAFEYPSNAVESVTQDTFRVFFKGSELVVAGKLREQSPDVLLAQIRGQLHRENITYMMMSHVAEQEEMFRSPKYIFHSFIERLWAYLTIQQLLEQMVSALDAEKQALEARALSLSLSYSFVTPLTSMVITKPEGQEQSQVAEKPVEDESRGSRVYLGPMRFGHSVGDRTSRKPGGGLKLLNGTPLFGPPGPPAAASPFHRMTSRLVLPELMSPLAPASAPSPTSGPGGASHDTDFRIKGTTPTALPFAPVQAPSVILPLPGQSVDRLCVDLRRPQELVNLLSDPDQGVEVTGHFETAKARFSWIEVTFENPQVQIHASPEHVVMTRNRRNSAYKWKETLYSVMPGLKVTMDKEGLLLLSRPDRVTIGLLFWDGPGKGLRLLLQNTDRFSSHVSGTLGQFYQDVLWGPLDTADDSKRTLKVQGRDYSATRELKLDYQESPPGKEISCWSVEL
>sp|P01045|P01045_BOVIN Kininogen-2 OS=Bos taurus (Bovine) OX=9913 GN=KNG2 PE=1 SV=1
MKLITILFLCSRLLPSLTQESSQEIDCNDQDVFKAVDAALTKYNSENKSGNQFVLYRITEVARMDNPDTFYSLKYQIKEGDCPFQSNKTWQDCDYKDSAQAATGQCTATVAKRGNMKFSVAIQTCLITPAEGPVVTAQYECLGCVHPISTKSPDLEPVLRYAIQYFNNNTSHSHLFDLKEVKRAQKQVVSGWNYEVNYSIAQTNCSKEEFSFLTPDCKSLSSGDTGECTDKAHVDVKLRISSFSQKCDLYPGEDFLPPMVCVGCPKPIPVDSPDLEEALNHSIAKLNAEHDGTFYFKIDTVKKATVQVVGGLKYSIVFIARETTCSKGSNEELTKSCEINIHGQILHCDANVYVVPWEEKVYPTVNCQPLGQTSLMKRPPGFSPFRSVQVMKTEGSTTVSLPHSAMSPVQDEERDSGKEQGPTHGHGWDHGKQIKLHGLGLGHKHKHDQGHGHHRSHGLGHGHQKQHGLGHGHKHGHGHGKHKNKGKNNGKHYDWRTPYLASSYEDSTTSSAQTQEKTEETTLSSLAQPGVAITFPDFQDSDLIATVMPNTLPPHTESDDDWIPDIQTEPNSLAFKLISDFPETTSPKCPSRPWKPVNGVNPTVEMKESHDFDLVDALL
>sp|A5PKC2|A5PKC2_BOVIN LAM_G_DOMAIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SHBG PE=2 SV=1
MVSRGPLAIWHGLLLLLLLPLPSHGGPALRPPLPSQTTEDSPALHLSSGPGQEPVTIMTFNLTKITKISSSFEFRTWDPEGVIFYGDTNPKNDWFMLGLRDGRPEIQLHNHWAQLTVSAGPRLDDGKWHQMEVKIHGDSLLLRVDGVEVLCLRQVFGQQANNSQLIMRIALGGLLFPASDLRLPLVPALDACLRQDDWLDQQAQTSASVPTSVRSCAVESQPGIFFPPGTGAEFGLQEIPRPHAEPWAFSLDLALQLAAGSGRLLALGTPENPSWLSIHLQDQKVVLSSGSGPGLDLPLILGLRLQLNLTVSGVVLSQGAKKEILALPPTGPGSLLDLWVQPHGRLFLGALPGEATSASFCLDGLWAQGRSLDMDRAQSRSLNIWTHSCPQNPGNGSDTTH
>sp|Q05443|Q05443_BOVIN Lumican OS=Bos taurus (Bovine) OX=9913 GN=LUM PE=1 SV=1
MNLGVFPLLLALIGGASSTYPDYYEYYDFPQALYGRSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDDKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLVDLQLTNNKISKLGSFDGLVNLTFIHLQHNQLKEDAVSAALKGLKSLEYLDLSFNQMTKLPSGLPVSLLTLYLDNNKISNIPDEYFKRFSALQYLRLSHNELADSGVPGNSFNVSSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNHITQTSLPPDMYECLRVANEITVN
>sp|F1MX87|F1MX87_BOVIN MACPF domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=C8A PE=4 SV=1
MFAAAFFLLFLMTYQPGVTIQEKVNWRVSRAVQSFTPTAVSCQLDNWAEWTDCFPCQDKKYRYRSLLQPNKFGGTICSGNVWDQASCHSPTACLSQAQCGQDFQCKETGRCLKRHLVCNGDKDCLDGSDEDDCEDVRILENDCSQYDPIPGSEKAALGYNILTQEEAQHVYDARYYGGQCETVYNGEWRELQYDPACERLYYGDDDKYFRKPYNFLKYHFEAQADTKISSEIYNDANDLLTKVKNDKSVSSGLTIGVGIRGVPVTVTAGVSMSKDAAFLKKLSKYHEKKYSFMRIFTKVQTAHFKMRRENIVLDEGMLQSLMELPERYHYGMYAKFINDYGTHYITSGSMGGVYEYILVLNREKMETAGVTSAEIQKCFGVSLGIEYEYSEAIQIKGSSSLGPCKKSGDGKLTENEKAMGVEDFISRVRGGSSGWGGSLTQDSSLVTYRSWGRSLKYNPAVIDFEMKPIHEILQHTNLGSLETKRQNLRRALDKYLMEFNACRCGPCFNNGEPILEGTSCKCQCPVGHQGLACEQMQSEGAQADGRWSCWSSWSACRSGTQERRRECNNPAPQNGGASCPGHRVQTQAC
>sp|Q95121|Q95121_BOVIN Pigment epithelium-derived factor OS=Bos taurus (Bovine) OX=9913 GN=SERPINF1 PE=1 SV=1
MQALVLLLWTGALLGFGRCQNAGQEAGSLTPESTGAPVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSGESPTANVLLSPLSVATALSALSLGAEQRTESNIHRALYYDLISNPDIHGTYKDLLASVTAPQKNLKSASRIIFERKLRIKASFIPPLEKSYGTRPRILTGNSRVDLQEINNWVQAQMKGKVARSTREMPSEISIFLLGVAYFKGQWVTKFDSRKTSLEDFYLDEERTVKVPMMSDPQAVLRYGLDSDLNCKIAQLPLTGSTSIIFFLPQKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTIPKLKLSYEGELTKSVQELKLQSLFDAPDFSKITGKPIKLTQVEHRVGFEWNEDGAGTNSSPGVQPARLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGT
>sp|Q2KJ63|Q2KJ63_BOVIN Plasma kallikrein OS=Bos taurus (Bovine) OX=9913 GN=KLKB1 PE=2 SV=1
MIALRQAAYFICLFATVSCGCLTQLYHNIFFRGGDVSAMYTPDAQYCQLMCTFHPRCLLFSFLPENSTSDADKRFGCFLKDSVTGTLPRVSRTGAISGHSLKRCGHQISACHRSIYKGIDMRGVNFNASKVRSAKECQERCTNNIHCQFFTYATKTFFSAEYRNTCLLKRSPQGTPTRIKVLSDVESGFSLKACGNSKIGCRVDIFQHSAFSDVDVAGIIAPDAFVCRTICTYHPSCLFFTFYTNAWKTDSQRNVCFLKTSQSGSPSSPTPQENAISGYSLLTCKQTLPGTEPCHSKIYPQVAFEGEELHVTFVKGVDGCQETCTKMIRCQFFTYSLFPEDCRGEKCKCSLRLSLDGSPTNITYGTQASSGYSLRLCKRGDSRVCTTKRTRIVGGTNASWGEWPWQVSLQVKQRAQSHLCGGSIIGRQWVLTAAHCFDGLLLSNIWRIYGGILNLSEITTETSFSQIKEIIVHPNYKISEGSHDIALIKLEAPLNFTDLQKAICLPSKDDTKPVYTDCWITGWGFTEEKGKIQNTLQKANIPLISNEECQKSYRDYKITKQMICAGYKEGGKDACKGDSGGPLVCQHEETWHLVGITSWGEGCARREQPGVYTKVAEYVDWILEKTQDSHGQPLRK
>sp|Q9N2I2|Q9N2I2_BOVIN Plasma serine protease inhibitor OS=Bos taurus (Bovine) OX=9913 GN=SERPINA5 PE=1 SV=1
MRLCLFLCLVLLGPRMATLRRSQKKKIQEVPPAVTTAPPGSRDFVFDLYRALAAAAPAQNIFFSPLSITVSLAMLSLGAQSNTKAQILEGLGIGPGEGSEEELHSASQRLLRELQQPQDSLQLSLGNALFTKPRLPIQEAFLGAMRTLYLADTFPTNFEDPEGAKKKINDYVAKQTKGKIVDLIKSLDGTQVMVMVNYIFFKAKWETSFNLKSTHEQDFYVTPETVVRVPMMKQQDQFYYLLDRNLSCKVVGVPYQGNATAFFILPREGEMEQVENGLKEKTLKKWLRMPMKRRLELYLPKFSIEGSYQLEEVLPKLGIRDIFTSDADLTGISNHSSIRVSEMVHKAVVEVDESGTQAAAATGMVITFKSARLGSQRIVFNRPFLVLIVKNSKHILFLGKVTRP
>sp|E1B726|E1B726_BOVIN Plasminogen OS=Bos taurus (Bovine) OX=9913 GN=PLG PE=3 SV=2
MLPASPKMEHKAVVFLILLFLKSGLGDLLDDYVNTQGASLLSLSRKNLAGRSVEDCAAKCEEETDFVCRAFQYHSKEQQCVVMAENSKNTPVFRMRDVILYEKRIYLLECKTGNGQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFPLAGLEENYCRNPDNDENGPWCYTTDPDKRYDYCDIPECEDKCMHCSGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPSKNLKMNYCRNPDGEPRPWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESGHTCQRWSEQTPHKHNRTPENFPCKNLEENYCRNPNGEKAPWCYTTNSKVRWEYCTIPSCESSPLSTERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGLTMNYCRNPDADKSPWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADCMIGMGKSYRGKKATTVAGVPCQEWAAQEPHHHSIFTPETNPQSGLERNYCRNPDGDVNGPWCYTMNPRKLFDYCDVPQCESSFDCGKPKVEPKKCSGRIVGGCVSKPHSWPWQVSLRRSSRHFCGGTLISPKWVLTAAHCLDNILALSFYKVILGAHNEKVREQSVQEIPVSRLFREPSQADIALLKLSRPAIITKEVIPACLPPPNYMVAARTECYITGWGETQGTFGEGLLKEAHLPVIENKVCNRNEYLDGRVKPTELCAGHLIGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSPYVPWIEETMRRN
>sp|P06868|P06868_BOVIN Plasminogen OS=Bos taurus (Bovine) OX=9913 GN=PLG PE=1 SV=2
MLPASPKMEHKAVVFLLLLFLKSGLGDLLDDYVNTQGASLLSLSRKNLAGRSVEDCAAKCEEETDFVCRAFQYHSKEQQCVVMAENSKNTPVFRMRDVILYEKRIYLLECKTGNGQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFPLAGLEENYCRNPDNDENGPWCYTTDPDKRYDYCDIPECEDKCMHCSGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNLKMNYCRNPDGEPRPWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESGHTCQRWSEQTPHKHNRTPENFPCKNLEENYCRNPNGEKAPWCYTTNSEVRWEYCTIPSCESSPLSTERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGLTMNYCRNPDADKSPWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADCMIGTGKSYRGKKATTVAGVPCQEWAAQEPHQHSIFTPETNPQSGLERNYCRNPDGDVNGPWCYTMNPRKPFDYCDVPQCESSFDCGKPKVEPKKCSGRIVGGCVSKPHSWPWQVSLRRSSRHFCGGTLISPKWVLTAAHCLDNILALSFYKVILGAHNEKVREQSVQEIPVSRLFREPSQADIALLKLSRPAIITKEVIPACLPPPNYMVAARTECYITGWGETQGTFGEGLLKEAHLPVIENKVCNRNEYLDGRVKPTELCAGHLIGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSPYVPWIEETMRRN
>sp|Q29437|Q29437_BOVIN Primary amine oxidase, liver isozyme OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000039321 PE=1 SV=1
MFIFIFLSLWTLLVMGREEGGVGSEEGVGKQCHPSLPPRCPSRSPSDQPWTHPDQSQLFADLSREELTTVMSFLTQQLGPDLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGGQPQPNVTELVVGPLPQPSYMRDVTVERHGGPLPYYRRPVLLREYLDIDQMIFNRELPQAAGVLHHCCSYKQGGQKLLTMNSAPRGVQSGDRSTWFGIYYNITKGGPYLHPVGLELLVDHKALDPADWTVQKVFFQGRYYENLAQLEEQFEAGQVNVVVIPDDGTGGFWSLKSQVPPGPTPPLQFHPQGPRFSVQGNRVASSLWTFSFGLGAFSGPRVFDVRFQGERLAYEISLQEAGAVYGGNTPAAMLTRYMDSGFGMGYFATPLIRGVDCPYLATYMDWHFVVESQTPKTLHDAFCVFEQNKGLPLRRHHSDFLSHYFGGVAQTVLVFRSVSTMLNYDYVWDMVFYPNGAIEVKLHATGYISSAFLFGAARRYGNQVGEHTLGPVHTHSAHYKVDLDVGGLENWVWAEDMAFVPTAIPWSPEHQIQRLQVTRKQLETEEQAAFPLGGASPRYLYLASKQSNKWGHPRGYRIQTVSFAGGPMPQNSPMERAFSWGRYQLAITQRKETEPSSSSVFNQNDPWTPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDQEPSMDSADSIYFREGQDAGSCEINPLACLPQAATCAPDLPVFSHGGYPEY
>sp|Q2KIT0|Q2KIT0_BOVIN Protein HP-20 homolog OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000026666 PE=2 SV=1
MADLRILVSIILMTNAVLEKGGCTGPPGPPGHPGPPGIRGPPGIRGIPGLPGPPGTPGPSVKCPCHRQSAFTVKLSGQLPSPSKPVPFTEVLYNAQRDLQEDTGVFTCRVPGNYHFLFDVDLHHCKVTVQLMRDKSSVLEKHQVSTKEPRSLSGMLTLPLHVGEKVWLEAKVETEKPEQARVTIYFSGFLT
>sp|Q2KIX7|Q2KIX7_BOVIN Protein HP-25 homolog 1 OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000030683 PE=1 SV=1
MPGGRRRVGSMNIAGFWILAQFVLLLVANVKSSADSELCGPRGARGPPGLSGLPGPPGYTGPIGMPGLTGRPGLPGLVEKCPPLPQSAFSVKLSGPFPGPSQPIVFQEVLYNHQGHFDPATGVFNCSVPGVYHFGFDIELFQSAVKVGLMRNGIQIRDKRAEAGDSHEQASGSSVLELEKGDRVWLESKLDREESEKGTTHAVFYGFLLNGN
>sp|Q2KIU3|Q2KIU3_BOVIN Protein HP-25 homolog 2 OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000018556 PE=2 SV=1
MPGRGGQSLSMVCVDVWILALSVLSVMADATSVPVTESCDSQGPPGLPGPPGLPGPPGPPGPPGPPGLRGPTGIPGDIESCLSPPKSAFAVKMNDPLPAPSQPIVFKEALHNDQDHFNLTTGVFTCTIPGVYRFGFDIELFQHAVKLGLMKNDTQILEKESKAKDNYRHLSGNVVLQLTLGDRVWLESKLDTTETEKGPIQSMFFGYLLYGNYPG
>sp|F1N0X0|F1N0X0_BOVIN Protocadherin 12 OS=Bos taurus (Bovine) OX=9913 GN=PCDH12 PE=4 SV=1
MMRFLSLLGLLGPGGYLFLSGDCQEVATLTVRYQVAEEVPSGTVIGKLPQERGREEEPGQAGAAFQVLQLPQGLPIQVDSEDGVLSTGRRLDREQLCRQQDPCLVSFDVLATGERALIHVEIQVLDINDHQPQFPKGEQELEISESASLRTRIPLDRALDPDTGPNTLHSYTLSPSEHFALDVIVGPDQTKHAELVVVKELDREIHSYFDLVLTAYDSGNPPKSGTSLVKVSVLDSNDNSPVFAESSLALEIQEDAAPGTLLINLTATDPDQGPNGEVEYFLSKHVPLEVLNTFNIDAKTGQVTLLQHLDYEKNPAYEVDVQARDLGPNPIPAHCKILIKVLDVNDNAPSIHITWASQPLLVSEALPKDSFIALIMANDLDSGNNGLVHCWLSQELGHFRLKRTNGNTYMLLTNATLDREQWPQYTLTLLAQDQGPQPLSDKKQLSIQISDANDNAPVFEKSRYQVSTRENNLPSLHLITIKAHDADLGVNGKISYRIQDSPVAHLVAIDSDTGEVTAQRSLDYEQMASFEFLVIAEDSGQPQLSSSVSVWVSLLDANDNAPEVIHPILSNGRASLSVLVNASTGHLLVPIENPNGLGPAGTDIPLQATSSSRPFLLVTIIARDADSGANGELLYTIRSGNEAGVFVLSPNLGQLFINVTNASSLTGSEWELEIVVEDRGSPSLQTRALLQVLFVTSVDHLRDSAREPGALSTSVLTVICLVVLLAVFGSILALITSICRTEKKDNRAYNCREAESTYRHQPKRPQKQIQKADIQLVPMLRGQVDEPGEVGQPPKHVGEEAMMEAGWDSCLQAPFHLTPTLYRTLRNQGNQGTLAESREVLQDTVNLLFNHPRQRNASRENLHLAEPQPAVGQPRSRLLKAAGSPTGRVPGDQGSEEAPQSPPASSATLRRQRNLNGKVAPEKESGPRQILRSLVRLSVAAFAERNPVEELTVDSPPVQQISQLLSLLHQGQFQPKPNHRGNKYLAKPGSSRSTIPDTDGPGARAGGQAEPDQEEGPLDPEEDLSVKQLLEEELSNLLDPHTGLALDRLSVPDPAWMARLSLPLSTNYRDNVFSPDAATSEEPRTFQTFGKAPELSPTGTRLASTFLSEMSSLLEMLLEQRPAVPVEAASEVLRRLSVCGRTLSLDLATSGAAGSEGLTGLAGNKGAESRTSSGSSSSRGQWIQEPGTLGDVRKPRP
>sp|A2I7N1|A2I7N1_BOVIN Serpin A3-5 OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-5 PE=3 SV=1
MRAERTSFLLALGLLMAGIRSVHCLPENVVVKDQRRRVDSHTLASSNTDFAFSLYKQLALKNPNKNVMFSPLSVSMALAFLSLGARGPTLTEILEGLKFNLTEIQETQIHQGFQHLLQALNRPSNQLQLSVGNAMFVQEELKLLDKFIEDARVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTVLVLVNYIYFKAQWKTRFDPKHTEQAEFHVSKNKTVEVPMMTLDLETPYFRDKELGCMLVELTYSSNDSALFILPDEGKMQDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDTLSQMGIKKIFTDADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA
>sp|A6QPQ2|A6QPQ2_BOVIN Serpin A3-8 OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-8 PE=2 SV=1
MRAERMSPLLALGLLVSGLCSRVHCLPENVTPEERHKGTSVDGHSLASSNTDFAFSLYKQLALKNPNKNVIFSPLSISIALAFLSLGARGPTVTEILEGLKFNLTETLEREIHQGFQHLLQMLSRPSNELQLSVGNTMFVQEQLKLLDKFREDALALYTSEAFSTNFKDPETAKSLINDYVKNKTRGKIVDLFKDLDPLTKVILVNYIYFKAQWRTPFDPKQTYKSQFHVSKNKTVEVPMMSIGDLVTPYFRDEELDCTLVELTYTSNDSALFILPDEGKMQDLEAKLIPEMLTRWRESLYPRGIHELNLPRFSIATDYKLKDILSQLEIKKVFTQEADLSGITDDHELEVSQVVHKAVLDVGEEGTEGAAATGVKVGITSINNHIPLSFNRPFLIAIVLKDTQSIIFLGKVTNPSQA
>sp|Q3SYR0|Q3SYR0_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPINA7 PE=2 SV=1
MPLFSLVLLILGLHCAPPNSCEGKITSCLSPQQNATLYKMSSINADFAFNLYRRFTVEIPDQNIFFSPVSISAGLAMLSLGACSSTQTQILEGLGFNLTDTPVAEIQQGFQHLICSLNFPKKELELQMGNALFIGKQLKPLEKFLDDVKNLYETEVFSTDFSNVSAAQQEINSHVEKQTKGKIVGLIQDLKPNTITVLVNYLCFKAQWANPFDPSKTEEGSSFLVDKTTTVQVPMMHQMEQYYHLVDTELNCTVLQMDYSKNALALFVLPKEGQMEWVEGAMSSKTLKKWNRLLRKGWVDLFVPKFSISATYDLGDILLKMGIQDAFADNADFSGLTKDNGLKVSNVAHKAMFYIGEKGTEAVPEVRFLNQPETTLLHPIIQFDRSFLLLILEKNTRSILFLGKVVDPTEV
>sp|A5PJ69|A5PJ69_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPINA10 PE=2 SV=1
MWAVLSLPLACLLAQAWLVPGSTLASHSPEAQAGLETLLTPMAQNKTSQTSERQWAPEEEEEREEDSPWLLAEGQQLSREASNLGFSLLRKISLKHDGNVVFSPLGLAWAMAALTLGARGHSRAQLEDLLLQAWNQTWPVVNQTRPPRLPALFKQLQESLSHNPELGLAQGSFAFIHKDFDIRETFLNLSKRYFDMECVTVDFHNTSQAKRLINHYMNQETQGKLPKLFDEINPDTKLILVDYILFKGKWLIPFDPALTEMDTFYLDKYKEVKVPMMYRSGKFASTFDKKFHCHVLKLPYRGNASMLVVLVERIGDHLTLEDYLTTDLVDTWLRNMKTRKMEVFFPKFKLDQKYKMHELLKQMGVQKIFLPWADLSDLMVTERNLKVSKVLQRATIEVDEEGTEAMAGTLLEITAYYMPPIVKVDRPFLFIIYEETSRTVLFLGRVVDPTLL
>sp|A5PK77|A5PK77_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPINA11 PE=2 SV=1
MGPAWLWLLGAGILASVHCQPLPAHGDKSLRVPEAPRGQLSESLPAYQKITPTLTSFALRLYKQLAAETPGNIFFSPVSLSSTLALLSLGVQANTRTQILEGLGFNLTETPEADIHRGFQSLIHTLDLPSPKLELKLGNSLFLDTQLKPQQHILDNIRELYGVFAFSANFTNSDATRKQINGYVSRQTYGQVVDCLEEFTPDTLMVLLNYMFFKAKWKHPFNRYQTQKQESFFVDGRTSLRIPMMHQKEMHRFLYDQEVACTVLQLEYSGNAQALLILPDPGKMAQVEAALQPETLKKWDKLLLPSLLDLHLPKFSISGTYNLEEILPHIGLTGLFNSEADYSGITGQLNRTISRVSHKATVDVSERGTEAAVASSLLSQPRSLNATSAPHAGFNRPFLLLLWEVTTESPLFLGKVVNPAAG
>sp|Q3ZBS7|Q3ZBS7_BOVIN SMB domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=VTN PE=1 SV=1
MTSLRPLLMLALLAWVVVADQESCKGRCTEGFNATRKCQCDELCSYYQSCCADFMAECKPQVTRGDVFHLPEDEYGFHDYSDAQTVNSNVEAQPESTTLAPVLQAQTLETPVQAPVLNPEKEVPPSGRGDSEPGMGTSDLGTSESPAEEETCSGKPFDAFTDLKNGSLFAFRGLYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRVNCQGKTYLFKGSQYWRFQDGVLEPDFPRNISDGFGGIPDDVDAALALPAHNFNGRERVYFFKGNHYWEYVFQQQPSQEDCEGSSLPAAFKHFALMQRDSWVDIFRLLFWGGSYGGAGQPQLISRNWFGLPGRLDAAMAGHIYVSGSAPSFPRAKMTKSARRHRKRYRSLRSRGRGRGRNQNPYRRSRSAFLSWLSSEELGLGANNYDSFEMDWLVPATCEPIQSVYFFSEDKYYRVNLRTRRVDAVIPPYPRSIAQYWLGCPVPGQA
>sp|O46375|O46375_BOVIN Transthyretin OS=Bos taurus (Bovine) OX=9913 GN=TTR PE=1 SV=1
MASFRLFLLCLAGLVFVSEAGSVGAGEPKCPLMVKVLDAVRGSPAANVGVKVFKKAADETWEPFASGKTSESGELHGLTTEDKFVEGLYKVELDTKSYWKSLGISPFHEFAEVVFTANDSGPRHYTIAALLSPYSYSTTALVSSPKA
>sp|G3N0V0|G3N0V0_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000048135 PE=1 SV=1
ASTTAPKVYPLASRCGDTSSSTVTLGCLVSSYMPEPVTVTWNSGALKSGVHTFPAVLQSSGLYSLSSMVTVPASTSGQTFTCNVAHPASSTKVDKAVGVSIDCSKCHNQPCVREPSVFIFPPKPKDTLMITGTPEVTCVVVNVGHDNPEVQFSWFVDDVEVHTARTKPREEQFNSTYRVVSALPIQHQDWTGGKEFKCKVNNKGLSAPIVRIISRSKGPAREPQVYVLDPPKEELSKSTLSVTCMVTGFYPEDVAVEWQRNRQTESEDKYRTTPPQLDTDRSYFLYSKLRVDRNSWQEGDTYTCVVMHEALHNHYTQKSTSKSAGK
>sp|F1MH40|F1MH40_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000003408 PE=1 SV=2
MRFSAQLLGLLLLWVPGSSGDVVLTQTPLSLSIIPGEMASISCKSSQSLVHSDGKTYLNWIQYKPGQSPQGLIYQVSNRYSGVSDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGTEDPPTFSQGTKLEVKRSDAEPSVFLFKPSDEQLKTGTVSVVCLVNDFYPKDINVKWKVDGVTQSSSNFQNSFTDQDSKKSTYSLSSILTLPSSEYQSHDAYTCEVSHKSLTTTLVKSFSKNEC
>sp|F1MLW8|F1MLW8_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=LOC100847119 PE=1 SV=2
MAWTPLLLPLLTLCAGHLASSQLTQPPAVSVSLGQTASITCQGDDLELLSAHWYQQKPGQAPVLVIYADDNLASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSADPVSLCDLFGGGTRVTVLGQPKSPPSVTLFPPSKEELSANKATLVCLISDFYPGSVTVAWKADGSTITRNVKTTRASKQSNSKYAASSYLSLTDSDWKSKGSYSCEVTHEGSTVTKTVKTSACS
>sp|P07224|P07224_BOVIN Vitamin K-dependent protein S OS=Bos taurus (Bovine) OX=9913 GN=PROS1 PE=1 SV=1
MRVLGGRTGTLLACLALVLPVLEANFLSRQHASQVLIRRRRANTLLEETKKGNLERECIEELCNKEEAREIFENNPETEYFYPKYLGCLGSFRAGLFTAARLSTNAYPDLRSCVNAISDQCNPLPCNEDGFMTCKDGQATFTCICKSGWQGEKCESDINECKDPVNINGGCSQICENTPGSYHCSCKNGFVMLSNKKDCKDVDECVLKPSICGTAVCKNIPGDFECECAEGYKYNPVSKSCDDVDECAENLCAQLCVNYPGGYSCYCDGKKGFKLAQDQKSCEAVPVCLPLDLDKNYELLYLAEQFVGVVLYLKFRLPETTRFSAEFDFRTYDSEGVILYAESSDHSAWFLIALREGKIEIQFKNEKTTKMTTGGKVINDGLWHMVSVEELEQSISVKIAKEAVMNINKPGSLFKPTNGFLETKVYFAGVPRKMENALIRPINPRLDGCIRGWNLMNQGTSGVKEIIQEKQNKHCLVNVEKGSYYPGTGVAQFSINYKNESNPEAWQINVSLNIRPSAGTGVMLALVSDNTVPFALSLVDSATEKLQDILVSVESMVIGRIEAISLCSDQQTFLEIRVNRNNLELSTQLRKDSFHSEDFQRQFAILDEAMKGTVVTYLGGLPDVPFSATPVNAFYQGCMEVNINGVQVDLDEAISKHNDIRAHSCPSVWQKTKHT
>sp|G3X6N3|G3X6N3_BOVIN Serotransferrin OS=Bos taurus (Bovine) OX=9913 GN=TF PE=1 SV=2
MRPAVRALLACAVLGLCLADPERTVRWCTISTHEANKCASFRENVLRILESGPFVSCVKKTSHMDCIKAISNNEADAVTLDGGLVYEAGLKPNNLKPVVAEFHGTKDNPQTHYYAVAVVKKDTDFKLNELRGKKSCHTGLGRSAGWNIPMGKLYKELPDPQESIQRAAANFFSASCVPCADQSSFPKLCQLCAGKGTDKCACSNHEPYFGYSGAFKCLMEGAGDVAFVKHSTVFDNLPNPEDRKNYELLCGDNTRKSVDNYQECYLAMVPSHAVVARTVGGKEDVIWELLNHAQEHFGKDKPDNFQLFQSPHGKDLLFKDSADGFLKIPSKMDFELYLGYEYVTALQNLRESKPPDSSKDECMVKWCAIGHQERTKCDRWSGFSGGAIECETAENTEECIAKIMKGEADAMSLDGGYLYIAGKCGLVPVLAENYKTEGESCKNTPEKGYLAVAVVKTSDANINWNNLKDKKSCHTAVDRTAGWNIPMGLLYSKINNCKFDEFFSAGCAPGSPRNSSLCALCIGSEKGTGKECVPNSNERYYGYTGAFRCLVEKGDVAFVKDQTVIQNTDGNNNEAWAKNLKKENFEVLCKDGTRKPVTDAENCHLARGPNHAVVSRKDKATCVEKILNKQQDDFGKSVTDCTSNFCLFQSNSKDLLFRDDTKCLASIAKKTYDSYLGDDYVRAMTNLRQCSTSKLLEACTFHKP
>sp|E1BH06|E1BH06_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=C4A PE=1 SV=3
MRLLWGLIWASCFFALSLQKPRLLLFSPSVVRIGVPLSVAVKLQDAPSGQVVRGSVFLRNPSHVNELCSPKVDFSLSSDRDFILLNVPIPQAQARICFLHLRRVPEVQLMVQSSWLRDSLSKQTDMQGVNLLFSSRRGHLFLQTDQPVYNPGQRVRYRVFALDQKMRPATDILTVTVENSQGFRVQKREVFAPFSIFQDSFLIPDISEPGTWKISARFSDSLDSNSSTQFEVKKYVLPNFEVKIIPENPYILTTPGFLSDIQVIIQARYIYGKPVQGVAYVRFGLLGEDGEKTFLRGLESQTKLVDGQCQISLQKAEFQGVLEKLNISTDDLPGLRLYVAAAVIESPGGEMEEAELTSWRFMSSPFSLDLSKTKQQLIPGVPFLLQALVRDMSGSPASSIPVKVSAKLFSGSTSKNQDFEQNTDGSGQVIVSIGVPRTISEVQLSVSAGSPYPAVGSLTVKAPLSRSSGFLSIEWQNPRPLKVGETLKLNLQAVGISGSFSYFYYMIVSRGQIVSVHREPRSHLTSISVFVDHHLVPSFHLVAFYYHGGVPVANSLRVDVQAGGCEGKLELNVDSSKAYRPGDTVKLNLKTESRALVALGAVDTALYAVGGKSHKPLDMVKVFEAMNSYDLGCGPGGGDTAPQVFKAAGLAFSDGDHRTEIRKSLSCPKESKSRKKRNVNFQKAIHEKLGQYTSPVAKRCCQDGLTRLPMARTCEQRAARVQQPACRKPFLSCCQFAESLRKKARTRGQVGLARAMELLQEEDLIEEDDIPVRSFFPENWLWKVEEVDRFSQLRLLLPDSLTTWEIHGMSLSKTTGLCVATPARLRVFREFHMHLRLPVSVRRFEQLELRPVLYNYLDSDLTVSVHVSPVEGLCLAGGGGLAQQVQVPAGSARPVGFSVVPIAAAAVSLKVVARGSFDFPVGDAISKILQVEREGALHREEMVYELNPLDPLGRTLEIPGNSDPNIIPEGDFKSFVRVTASDPLEALGSEGALSPGGLASLLRLPQGCAEQTMTLLAPTLAASRYLDKTEQWSMLPPETKDRAVDLIQKGYTRIQEFRKRDGSYGAWLHRDSSTWLTAFVLKILSLAQDQVGGSAEKLQETATWLLSQQRDDGPFHDPCPVIHREMQGGLVGSDETVALTAFVVIALHHGLAVLPDKNSEQLRRVENSISRANTFLGAKATSGLLGSHASAITAYALSLTEAPEDLRRVAHNNLMAMAKDIGDKLYWGSVTTSPSNVLSPTPAPRSPADPIPQAPAMSIETTAYGLLHLLLWEGKAELADQAASWLTRQGSFQGGFRSTQDTVVALDALSAYWIASYTAEEKGLNVTLSSLGRSGLKSHVLQLTNHQVHRLEEELQFSLGSKINVEVRGNSKGTLKVLRSYNVMDMTNTTCQDLQIEVTVMGHVEYTMEAEEDYEDYEYEDLLAGDDPEAHSRPVTPLQLFDGRRNRRRREAPKAAEERESRVQYTVCIWRTGKVGLSGMAIADITLLSGFHALRADLEKLTSLSDRYMSHFETEGPHVLLYFDSVPTSRECVGFGAVQEVPVGLVQPASAILYDYYNPEHKCSVFYGAPRKSKLLSTLCSADVCQCAEGKCPRQRRALERGQQDLEGYRMKFACYSPRVDYGFQVKVLREDSRAAFRLFETRITQVLHFTKDARATADQTRNFLVRASCRLQLEPGKEYLIMGLDGATYDLKGDPQYLLDSNSWIEEMPSERMCQSTRHRTPCAQLNSFLQEYGTQGCQV
>sp|E1BNR0|E1BNR0_BOVIN Vitellogenin domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=APOB PE=1 SV=3
MGAPRPAVLLLLLLLFLDAANAQARDEVLENVSPSCPKDAVRFKHLRKYVYNYEAESSSGVPGTADSRSATKINCKVELEVPQLCNFILKTSDCTLKEVDGLNPEGKALLKKTKNSEEFAAAMSKYDLKLAVPEGKQVLLYPEKEEPKHILNIKRGIISALLLPPETEEAKQVLFLDTVYGNCSTDFTVKTKKGNVATEISIERNLEKCDHFQPISTGVSPLALIRGMTRPLSTLIGSSQSCRYTLDPRKKHVSEAICNEQHLFLPFSYKNKYGMMAQVTQTLKLENTPKINSRFFEEGTEAVGLAFESTRSTSPPNHAEAIVKTLQELQKLHVSEQNAQRANLFHKLVTELRGLSSEAVTSLLPKLIEVSSPITLQALIQCGQPQCYTHILQWLKNERANPLLIDAVTYLVALIPEPSAERLREVFNTARVQQSRLTFYALSHMINNYHKTNPTWTQDLLEIADYLSEQIGNDCTGNEDLTYLILRVIGNIGKTMEQLTPKLTSSVLKCIRSEQPSLVIQKAAIQALRKMELSDEVREVLLQTFLDDTSPGDKRLAAYLMLMGSPSQSDISKITQLLSGEQNEQVKNFVASHIANILNSEDLYVQDLKSLVEEALKKSQLPTIMDFKKFSRSYQFSKSISLPSLDLVSAKIEGNLIFDPNNYLPKESMLKTTLKVFGFASADLFEIGLEGKGFEPTLEALFGKEGFFPDSVNKALYWVNGRVPDRVSKVLVDHFGYTKDDKHEQDMVNGVMFNVEKLVKDLKSKDFPEARAYLRILGEELGFVKLHDLQLLGKLLLKGVRTLQGIPQMIKELIRKGSTSDLFLHYIFMDNAFELPTGLGLQLQVSSSGIITPGIKAGVKLEVADMQAELVTKPSVSVEFVTNMGIVIPDFARSGVQMNTNFFHETGLEARVVLKAGQLKFIIPSPKRPVRLFSGSNTLHLVSTTKTEVIPPLIENRQSWSTCKPFFIGLNYCITGAYSNASSTDSSSYYPLTGDTRFELELKPTGEVEQYSAKAFYELRRDGEALVDMLKLVTQTEGVKQTEATLLFRYNRQSKTLSSELHIPDFDIDLGTVLKVNYEHSKEKKSYKLTLDFQNKKITEVTLTGHISYDRKEEGKIKGVISIPRLQAEARSEILSLWSPSKLLLQMDSSATAYGSTISKKVAWRYDGDKIEFEWNTGTNVDTKKATSNFPVDLSAFPKSLHTYANILLDRRVPQTDLTFRHMGSKLVAAASTWLQETSRSLPYAQNIQDQLSGLQELCLQKMELPNFHIPDNLFLKSDGRIKYTLNKNSMEIEIPLPFGGKSSEDLKMFKTIQTPALNFQPLGFHLPSQEFQIPTFTIPNLYPLRLPLLGVLDLSTSIYSNLYNWSASYTGGNTSTDHWSLQAQYHVKADSVVNLLSYHVQGSGKTAYDHRNTLTFSGDGSLHHKFLDSNVKFSLVEKRGNSPASEGLLTFDASSAWGPQISASVHLDSKKKEHLYVKEVKIDGQFRASAFYAKGAYDLSYQRDPATGQLTGESNLRFNSSYVQGTNQITGRYDDGTVSITSTSDLQDGLVKNTASLKYENYELTLKSDTNGKYEDFATSNKVDLTFSKQHALLRSEYQADYKALRFFTLLSGSLNSHGLELNADILGTDKINSGAHKATLRIARDGMSTSATTSLKYNPLVLENELNAAVSLSGASLKLTSNGRFREHHAKFSLDGKAAPTEVSLGSAYQAMILGVDSKNIFHFKINQEGLKLSNDIMGSYDEMKLDYTNNLNIVGFSLDFSSKLDNIYSSDKFYKQNFNLQLEPYSLVTTLNSDLKFSALDMTNNGKLRLEPLKLNVGGTIKGAYQNDEIKHIYTLSYADLSASYKADTVAKVQGTEFSHRLNTNIAGLASTVDIRTNYNSDSLHFSNAFHSAVAPFTMTIDTHTNGNGELVLWGQHTGQLYSKFLLKAEPLAFTFSHDYRGSTSHRLMSKRSITTALDHKVSALLTLAEQTGDWKLRTQLNQNEYSQDFSAYNTKDKAGVELSGRALADLTVLDFPIAVPLVLNEPINVIDTFEMRDSVGQPQEFTLVASVKYDKNQNAHTIHLPFFKFLPKYFEKTRVVVIGALETVQKELKRTHIDKHMRKYVEALDRLSQQVSDYLSTFNWERQVLSAKEKLTAFTENDLQIVLDNATINLNEKLSQLQTYVIQFDQYFEDNYDLHDFKTTIAKIIDQIIEKLKILDEHYHIRVNLVKKIRDLYFFIENFDFNKTESSTASWIQNMDTKYQIRIQIQEKLQQLKVQIQTVDIHHLAEMFKQQVEAVDVRVLLDQLRTTIPFQRIKEIIEHVKYRVTSLSEGFKVTEEINAFRVMVHEFIKMYKIDQHIQALMDKSVQLAQQYKLQETVQKLSSVLQQVKMAEIVEKLIGLTDNALKQLEALSFNQFLEEVNRFLDMLVKKLRSFDYHQFVDETNNKIHEVTQRINDEIQALEFPQKAKALRLLVEDARIVVSTYLENLKATKITLVLDWLQEALSSTSVTYMKAKFQETLEDFRDRVYQMDVQQELQRYLFLVGQVYNTLVTYISDWWALAAKNLTDFAEQYSIQDWAENLKTLVEQGFTVPEIQTTFGTIPAFKIGLRALQEATYQTPDFIVPLTDLRIPSFQINFKTLKDVKIPSSFSTPEFTILNTLHIPSFTIDFVEIKIKIVRTIDQMLNSELQWPVPEVYLGDLSGVDTILAGITVPDFHLPEITIPEFVIPNLNLTDFQVSDLHIPEFQLPHISHTIEVPAFGKLYSILKIQSPFFTLDANADIQNATALANQAEMEASITAKGASRLEVLNFDFQAKAQLSDPTLNPLVLKEFVRFSSKYLKTEHESEVLWVGNAIEGKSNTVAGIHTEKNTLKLSSSVLVNISNQLTLDSNTKYFHKLNIPQLDFSSQADLHSDLKTLLEAGHIAWASSGRASWKLACHEFSDEGTHESQSSFTVEESITSFRLSNKINSKHLRVNQKILYESRFLNFSKFEIQSQAECQHVGRSVLTAKGLALLQEGKAEITGNHDAHLNGKVVGTLRNSLFFSAQPYEMTASTNNEGNLRVSFPLKLTGKIDFLNNYALFLSPSTQQASWQASGRFNQYKYHQNFSAGNNEKSIEAHIGINGEANLDFLNIPLKIPEMTLPYTKLTTPQIKEISLWKKTGLKDFLKTTKQSFDLSVRAQYKKNKDKHSIPVPLDAFYALIHRNINSFSRLFETVRNQALDFFIKSYNEAKTTFDKYKVEKSLNQQPKIYKIPGYTIPVANIEVSPFTVKMLTFEYMIPKEISTPSITVLGSSISVPSYTLVLPFLELPALPVPKELSELSLPEFKVLSTINKILIPALGNITYDFSFKSSVITLNTNVGLYNQSDIVAHFLTSSSSVMDTLQYKLEGTSSLTRKRGLKLATALSLSNRFVEGNHDSTVSFTKKNVDASVTTTARVQIPILKMSFKQELHGNTKSKPTVSSAIELKYNFNSPKLLSAATGAVAHKLTLESLTSYFSIESSTKGGVEGSFGSWGYSGSLASEANTYLNSKGTRSSVTLQGASKADGLWDLKVKENFAGEATLQRIYIIWEQNMKNHLELGGLILTSGEHTSKATLELSLWKISALVQVRAHQPNSLLKINFLGQEVSLNVNTENQKISWNSEVQVPSGSLQNNIQLSNDQEVARFDMAVSLEGYLRFLKDTVLPVYDKSLWDLLKLNVTTSLNRKQYLRAATALIYTKNPNGYLVSIPMQELDDKFIIPGLKRNNQNSIHVTPTFQVPFTDLQIPSYTLDLSEIKIYKNLSTLPLTFNVSTLSQVKFPRVDVLIQYSKPEASSVPFFEITVPASQLTVSQFTLPKSISVGSTVLDLNTVASNIADSELPTITVPEQTLEIPSMKFSVPAGILVPSFGTLTARFEVASPLYNTTWSAGLKNKGDHVETFLDSTCSSTIQFLEYDLNVVGTHKIEGGMLVYKTNASFAHRDFSAEYEEDGKYQGLGYWNGKVDLNITSPTLTDVCLHYQEDENHFSSSVAFPAIGTVVIDVKNISDTVLGWNLYYRPQASPDKILNIFKIELRVLELDDEVQIKANWEEGAASELLSSLKDSVPRATGALYDYVNKYHQEYMGLDLKDATLKLRRGLQDSADQVYQGAMRQIDEVDMELQRMARGTTETYQQWKDKAQSVYQELLAQEDRSGFQRLQKVSDSLIGVTQGYSVTVKHATDLFIDLLNVTRFQLPGRARNYTADELCTVVIQEIAKRLSQVHSNIHKGLHILFSYLLYLMEESELYKELNNKFSFTSMCNQLIDMALECMKTFLFFSQEIQKALSYLQSTMMTEMLSDLQRSLQDIFQEIESELKRFKEKKLTDFINQTLQNINTISDIYISFVFRFLKENLNYNFVEFNKLIQNKLQVASQELQQLLQYVQALHQEYFDPTTVGWTVKYYEFEEKVINLIKNLVDVLKDFHSKYIVGATDFASQLSSQIEPLIQKSLQEYLSILANAEGRGKEKITELSTSAQEVIKSWAVAVKEIISDYHQQFTYKLQEFSDQLSDYCEKFISESKRLIDLSIQNYHMFLNYIMELLKELQSATINDMSPYIKVAPGEFTITF
>sp|F1MC45|F1MC45_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=LOC100336868 PE=4 SV=3
YRGYFPAHVNQQFVYNCDHYFVPPSQRSWDHLTCTAEGWSPEEPCLRQCIFNYLENGHTPHPEEKYLQGETVRVRCYEGYSLQNDQNTMTCTESGWSPPPRCIRVKTCSKSNIRIENGFLSKSTFTYPLNKQTEYKCKPGYVTADGKTSGLITCLQNGWSAQPVCIKSCDRPVFEKARVKSDGMWFRLNDRLDYECVDGYENRDGRTTGSIVCSQDGWSDKAACYERECSIPEMDPYLNAYPRKEIYKVGDVLKFSCSQGRIMVGADSVQCYHFGWSPKLPKCKARKVKSCAPPPQLLNGKGKKLHKEEYAHNEVVEYACNPRFLMKGSHKIQCVDGEWTALPVCIEEKRTCGDIPDLDHADIKPSVPPYHHGDSVEFSCREAFTMIGPRFITCISGEWTQPPQCIATDELRKCKWSTLFPPEGKPARRIEYDHSTNKSYQCRGKSEHKHSICINGKWDPKVDCKEEAQKQPCPPPPQIPNARDMTTTVKYQDGEKISILCKENYLIQDAEEIVCKDGRWQSIPRCTGKKIGCSQPPQIDHGTINSSSCAEERREIHEQRLYAHGTKLSYACEEGFEISENDVIICHMGKWSSPPQCAGLPPYILNGVVSHKKDSYQYGEEVTYKCDEGFGTDGPASVRCLGREWSCPQNCISTNCVNLPTFDDAVLIDQEKDFYRSGEQVAFKCLSYYQLDGSNTIQCIKSKWIGRTAYRDVSWVNPPQVENAIIHNQKSRYHSGEKAHYECIGNYDLFGEIHVVCLNGTWTKPPQCKGKCGPPPTIENGDITSLLKSVYPPGVIVEYRCQAYYELRGNRNVVCQNGEWSEPPKCLEACAISEETMKNHHIQLRWKHDTKLYSKTEDNIVFMCQHSYRRMTPQHTFRTTCQEGKVMYP
>sp|F1N1I6|F1N1I6_BOVIN Gelsolin OS=Bos taurus (Bovine) OX=9913 GN=GSN PE=1 SV=2
MSRKKSRPDSRPSPPAGAQPGPPPSQTGRSLAWAEWAGRLLKAGASLAAPAAPCLPPGSSAAVAAMAAHRCALLGALVLALGALSQPARLATPARPGATQARAPQGRVTEARPGSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNDIYQWCGSSSNRFERLKATQVSKGIRDNERSGRARVHVSEEGAEPEAMLEVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALRSEDCFILDHGKDGKIFVWKGRQANTEERKAALKTASDFISKMDYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGRGQKQIWRIEGSDKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYRGGTSREGGQTAPASTRLFQVRASSSGATRAVEVMPKAGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGALELLRVLRAQPVQVAEGSEPDSFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDNYWSVDPLDRALAELAA
>sp|F1MD83|F1MD83_BOVIN C-X-C motif chemokine OS=Bos taurus (Bovine) OX=9913 GN=PPBP PE=1 SV=2
MSLRPDATSSYTVPSPLPVLQVLLLMSLLLVMLVPSTNGKLSSKERFLHIELRCLCVKTISGIPSSNIQSLEVNRAGPHCNKVEVIAELKNGKKICLNPEGPRIKKIVQKILEDEPNSAEVSVSAPRFPTLHPKLPKKRADGGDKTGLERVGNHESAELQPCSPCAGSRLRLALLSAMNQAVVPRASRPRSSPGLLLLGLLLLPAIALAQESSFPATFVPLPADSEGGESEDLQCVCLKTTSGINPRHISSLEVIGAGLHCPSPQLIATLKTGRKICLDQQNPLYKKIIKRLLKS
>sp|E1BMJ0|E1BMJ0_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPING1 PE=3 SV=3
MASRLTPLTLLLLLLLAGDRVTSDMIVGPGNLQEGESEGDSQKGGILDGESIQGNEDSPTLPITNLTVVPATVTKPFSQPATEPVQSTIQPTAEPFCLAPVTSCSDSEIRSAEAVLGEALTDFSLRLYQDFSVLKKRETNFIFSPFSIASLLTQILLGAGGETRVSLERLLSYPQNFSCVHHALRAFMSEGFTSFSQIFHSSDLTIKDTFAEASQRLYGSSPRPLGNDSTASLELINDWVAKKTNLRIRRLLDSLPEDTRLILLNAVALSAKWKIAFDKGRTSTKPFHLKSSAIKVPMMNSKKYPVASFTDRTLNARVGRLQLSHNLSFVILVPQTVKHHLQDLEQALSTAVFKAVIKKLEMTKFHPTHLTMPRIKVQSSQDMLDYFDFIYDVNLCGLTEDPDVQVSGIRHQATLELTESGVEATAASVVSVARNLLLFEVQQPFLFLLWDQQHKFPVFMGRVYDPKG
>sp|F1MY85|F1MY85_BOVIN Complement C5a anaphylatoxin OS=Bos taurus (Bovine) OX=9913 GN=C5 PE=1 SV=3
MGLWGILCFLIFLGKSWGQEQTYVISAPKVFHVGAYENVVIQAYGYTEEFDATVSIKSFPDKKVTYSSGHVTLSAENKFQNSATLTIQPKQLSERQSSVSHVYLEVTSKHFSKAKKMPVTYDNGFLFIHTDKPVYTPHQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEENDYTGIISFPDFKIPSNPKYGVWTIRAKYKEDFSTTGTAYFEIKEYVLPHFSISIEPKSNFIGYKDFTNFEITIRARYFYNKVVNEADVYITFGIRDNLEDNQKEMMQKAMQSTALINGMAQVTFNSETAVKELSYESLEDLNNKYLYIGVTIIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFVKPGIPYSVKVQVKDSFDHLVGGIPVTLSAKTLDANQEITDLESKKSVTRSSDGVASFVVNLPSEVTVLEFNIKTEDLDLPEENQASEDYRAVAYSSLSQSYLYIDWTENYKHLLVGAHLNIVVTPRSPYIDKITHYNFLILSKGKIVHFGTRDKLSDSAYQSINIPVTQDMVPSARLLVYYIVTGEQTAELVSDSVWLNIEEKCGNQLEVHLSPETDAYSPGQRVSLNMETELDSWVALTAVDSAIYGVQRTAKRPLERVFQTLEKGDLGCGAGGGRDNAEVFYLAGLTFLTNANADDTRENDEPCKEILRPKRMLKKKIEEEAAKYRNAWVKKCCYDGAHRNDDETCEQRAARIQAGPICIKAFKSCCAIASQFRADEHHKNMQLGRLHIKSLLPVTKPEIRSYFPESWLWEVHRVPKRNQLQFVLPDSLTTWEIQGVGISNSGICVADTLKAKVFKSVFLEMNIPYSVVRGEQVQLSGTVYNYRTSGIQFCVKMHPVEGICSSGTPVTDSQGRRFSKCVLQKIEGSSNHLVTFTVLPLEVGLHNLSFSLETSVGNEILVKTLRVVPEGVKRESYAGVTLDPQGVYGIISRRKEFPYRIPLNMVPKTKVKRTVSIKGLLIGEIMSAVLSQEGIDSLTRLPKGNAEAELMSVVPVFYVYHYLEAGHNWDIFSTNSLTQKQNLKTKLKEGMVSIMSFRNADYSYSMWKGGSASTWLTAFALRVLGQISKYVDQNQNSICNSLLWLLEKCQLENGSFKENSDYQPVKLQGTLPVEAREKTLYLTAFAVIGIRKAFDICPLEKISTAVSKADIFLHENALSSQSAFTLAIAAYALSLGDKAHPQFRAIVSALKRKAFVKGNPPIYRFWKDDLQQRDSFVPNTGTARMVETTAYALLTNLNLKDMNYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVRKLRLNMDVKVSYKNKGDLYHYKMSDKYFLGRPIEVPLNDDLVVLSTGQSSGLATVHVKTVVHKISTSEEVCSFHLKIETREIEAFGYSSSEYKRIVACASYKLSSEESSSGSSHAVMDISLPTGVNANPEDLKALVEQVDQLLTDYEIKDGHVILQLNSIPSNEFLCVRFRIIELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNTKLQKVCEGVTCKCIEADCGQMQAELDLTISAATRKETACKPEIAYAYKVEIVAVTEENAFVKYTATLLDIYKAGEAAAERDAEITFIKKTSCSNANLEKRKQYLIMGKEALQIKHNFRFKYVYPLDSSTWIEYWPTDSRCPSCQRFLANLDEFTEDIFLNGCENA
>sp|F1MNL7|F1MNL7_BOVIN BPTI/Kunitz inhibitor domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=LOC616039 PE=4 SV=3
MSRLCLSAALLVLLGILVAGTREGDNSNKNDGLRPAFCLQPPYTGPCRAMFTRYFYNAVSGLCQTFTYGGCRRKPNNFRSEKECISTCGGRNRAQESLATVLPEMLKS
>sp|E1BCW0|E1BCW0_BOVIN HGF activator OS=Bos taurus (Bovine) OX=9913 GN=HGFAC PE=3 SV=3
MGCWARVASPCPPPGLALLLLLLLLPRGAQLQSARSQREPPGHNGTMTPVTPVTSVTPSTAAVGAPQTEGPPGGGLTPLPRGAPSNSPGGTVLTEAGQPCSFPFRYGGRMLHSCTTEGGAHRKWCATTHNYDRDRAWGYCVQDPAPRGGPALRDPCASGPCLHGGSCSSTQDPESHHCTCPAAFTGQDCGTEKCFDESRYEYLEPGERWARVHQGRVEQCECAGGQIRCEGTRHTACLSSPCLNGGSCHLIVATGTTVCACPPDYAGRLCNIVPAQRCFVGTGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDKDERPWCYVVKDSALSWEYCRLAACESLARIQPPPTEALLTLPGPTAAGPAGRQTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNNFCAGSLVHTCWVVSAAHCFSNSPPRESVSVVLGQHFFNRTTDVTQTFGIEKYIPYPLYSVFNPSDHDLVLIRLEKKGERCAVRSQFVQPICLPEPGSSFSPGHKCQIAGWGHQDENVSGYSPSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCRSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVDWINDRIRPNKRPASPS
>sp|F1MVK1|F1MVK1_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=LOC107131209 PE=4 SV=3
MRLLWGLIWASCFFALSLQKPRLLLFSPSVVRIGVPLSVAVKLQDAPSGQVVRGSVFLRNPSHVNELCSPKVDFSLSSDRDFILLNVPIPQEQARVCRLHLLRRAPEVQLMVQSSWLRDSLSKQTDMQGVNLLFSSRRGHLFLQTDQPVYNPGQQVRYRVFALDQKMRPATDILTVTVENSQGFRVRKREVFAPSSIFQDNFLIPDISAPGTWKISARFSDSLDSNSSTQFEVKKYVLPNFEVKIIPENPYILTTPGFLSDIQVIIQARYIYGKPVQGVAYVRFGLLGEDGEKTFLRGLESQTKLVDGQCQISLQKAEFQGVLEKLNISTDDLPGLRLYVAAAVIESPGGEMEEAELTSWRFVLSPFSLDLSKTKQQLIPGVPFLLQALVRDMSGSPASGIPVKVSAKLFSGSTSKNRDFEQNTDGSGQVIVSIGVPRTISEVQLSVSAGSPYPAVGSLTVKAPLSRSSGFLSIEWQNPRPLKVGETLNLNLRAVGISGSFSYFYYMIVSRGQIVSVHREPRSHLTSISVFVDHHLVPSFHLVAFYYHGGVPVANSLRVDVQAGDGVCVSKAYRPGDTVKLNLKTESRALVALGAVDTALYAVGGKSHKPLDMVKVFEAMNSYDLGCGPGGGDTAPQVFKAAGLAFSDGDHRTEIRKSLSCPKESKSRKKRNVNFQKAIHEKLGQYTSPVAKRCCQDGLTRLPMTRTCEQRAARVQQPACREPFLSCCQFAESLRKKARTRGQVGLARAMELLQEEDLIEEDDIPVRSFFPENWLWKVEEVDRFSQLRLLLPDSLTTWEIHGVSLSKTTGLCVATPARLRVFREFHMHLRLPVSVRRFEQLELRPVLYNYLDSDLTVSVHVSPVEGLCLAGGGGLAQQVQVPAGSARPVGFSVVPIAAAAVSLKVVARGSFDFPVGDAISKILQVEREGALHREEMVYELNPLDPRGRTLEIPGNSDPNIIPEGDFKSFVRVTASDPLEALGSEGALSPGGLASLLRLPQGCGEQTMTLLAPTLAASRYLDMTEQWSMLPPETKDRAVDLIQKGYTRIQEFRKRDGSYGAWLHRDSSTWLTAFVLKILSLAQDQVGGSPEKLQETAMWLLSQQRDDGSFHDPFPVMDRSMQGGLVGSDETVALTAFVVIALHHGLAVFPEKNSEQLRRVENSISRANTFLGAKATSGLLGAHASAITAYALSLTEAPEDLRRAAHNNLMAMAKDIGDKLYWGSVTTSPSNVLSPTLAPHSPADPIPQAPALWIETTAYGLLHLLLWEGKAELADQAASWLTRQGSFQGGFRSTQDTVVALDALSAYWIASHTTEEKGLNVTLSSLGRSGLKSHVLQLTNHQVHRLEEELQFSLGSKINVEVRGNSKGTLKVLRSYNVMDMTNTTCQDLQIEVTVMGHVEYTMEAEEDYQDYEYEDLLAGDDPEAHSRPVTPLQLFDGRRNRRRREAPKAAEERESRVQYTVCIWRTGKVGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETEGPHILLYFDSVPTSRECVGFGAVQEVPVGLVQPASAILYDYYNPEHKCSVFYGAPRKSKLLSTLCSADVCQCAEGKCPRQRRALERGQQDLEGYRMKFACYSPRVDYGFQVKVLREDSRAAFRLFETRITQVLHFTKDARATADQTRNFLVRASCRLQLEPGKEYLIMGLDGATYDLKGDPQYLLDSNSWIEEMPSERMCQSTRHRTPCAQLNSFLQEYGTQGCQV
>sp|F1MYN1|F1MYN1_BOVIN Pleckstrin homology domain containing A5 OS=Bos taurus (Bovine) OX=9913 GN=PLEKHA5 PE=4 SV=3
MAADLNLEWICSLPRSWTYGITRGGRVFFINEEAKSTTWLHPVTGEAVVTGHRRQSTDLPTGWEEAYTFEGARYYINHNERKVTCKHPVTGQPSQDNCIFVVNEQTVATMTSEEKKERPISMINEASNYNMTSDYAVHPMSPVGRTSRASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLDAALVQTEPVKRVDKITSENAPAKEINNFPNHRVLIKPEVQNNQKNKEMSRNEEKKALEAEKYGFQKDGQDRPLTKINSVKLNSLSSEYESGSTCPGQTGHYRPVNLNSSENKTVNVSLADLRGGSHPNTGPLHTEADRVIQRTNSMQQLEQWIKIQKGRGHEEETRGVISYQTLPRNMPSHRAPVMARYPEGYRTLPRNSKTRPESICSITPSAHDKTAGPGAEEKRRSMRDDTMWQLYEWQQRQFYNKQGTLPRHSSLTSPKTMVNISDQTMHSIPTSPSHGSIAAYQGFSPQRTYRSEVSSPIQRGDVTIDRRDVTIDRRDVTMDRRDMTMDRRDMTMDRRHRAHHPKHMYVPDRRSMPAGLTLQSVSPQSLQGKTPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQMKENEPIITMVHTMIENSALRPQLYQQFLRQRNKISLYCLSQDECRGTLYKYRPEEVDIDAKLSRLCEQDKVVHALEEKLQQLHKEKYTLEQALLSASQEIEMNADNPAAIQTVVLQRDDLQNGLLSTCRELSRATAELERAWREYDKLEYDVTVTRNQMQEQLDRLGEVQTESAGIQRAQIQKELWRIQDVMEGLSKHKQQRGTSETGMIGSKPFSTVKYKNEEEEVVPPRPPLPRSYDFTDQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKIHQVQGYPRNGSHCGPDYRLYKSEPELTTVAEVDESNGEEKSEPASEIETSVKGSHFPVGVVPPRTKSPTPESSTIASYVTLRKTKKMMDSRTERPRSAVEQLCLAESTRPRMTVEEQMERIRRHQQACLREKKKGLNLIGALDQSPLPSPSNLRDNPFRITQARRKDDNSKELDTVIRENDMKPNHDTPATDTVQLKEAEPQNTDFSGEFKKTENVFSETLFTPEPNGVNSEEVMDKEGDKKEVPEHVPYSPQEESQIPNHKPEGPPAEDTKDDIHEQEENVLSYELTPEASRGNQTMAAQSLPPSPDSSASPVPSAQPQLTEGSHFMCV
>sp|F1N076|F1N076_BOVIN Ceruloplasmin OS=Bos taurus (Bovine) OX=9913 GN=CP PE=1 SV=3
MKIFLLCIFLILCGTSAWAKDKHYYIGIIETAWNYASDHGEKKLISVDTEHSNIYLQNGPNRIGSVYKKAVYLQYTDENFRTVIEKPVWLGFLGPIIKAETGDKVYVHLKNFASRPYTFHAHGMTYYKEHEGAIYPDNTTDFQKADDKVQPGEQCMYILHANPEQGPGQEDSNCVTRIYHSHIDAPKDIASGLIGPLIHCKKDSLDEEKEKNIDKEFVVMFSVVDENLSWYLEENIKTYCSEPEKVEKDNEDFQESNRMYSVNGYAFGSLPGLSMCAKDRVKWYLFGMGNEIDVHAAFFHGQVLTSKNYRVDTINLFPATLFDALMVAQNPGQWMLSCQNLNHLKAGLQAFFWVQDCKKSSSKDNIHGKIRHYYIAAEEVIWNYAPSGIDAFTKENLRAPGSASEAFFEQGPTRIGGSYKKLVYREYTDASFSNQKQRGPEEEHLGILGKSVPVISAEVGDTIRVTFHNKAAHPLSIEPIGVRVDKKNEGTYYSPSGSGPPPSGSHVAPKGTFTYEWTVPREVGPTYKDPVCLAKMYYSAVDPTKDIFTGLIGPMKICRNGTLLANGRLKDVDKEFYLFPTVFDENESLLLDDNIKMFTTAPDQVDKENEDFQESNKMHSMNGFMYGNQPGLSMCQGDSVMWYLFSAGNEVDIHGIYFSGNTFLSRGERRDTANLFPQTSLSLFMKPDTAGTFDVECLTTDHYTGGMKQKYTVSQCSQRSEDLYLYLGERTYYIAAVEVEWDYSPSRKWEKELHHLQEQNLSNAFLDKEEFYIGSKYKKVVYRQFTDSTFQVPVQRKGEEEHLGILGPQLHANVGDKVNIIFKNMATRPYSIHAHGVKTESSTVTPTAPGETRTYIWKIPERSGAGRDDSPCIPWVYYSTVDRVKDLFSGLIGPLIVCRKHYLKVFNPIKKLEFSLLFLVFDENESWYLDDNIKTYSDHPEKVDKANEEFMESNKMHAINGRMFGNLQGLTMHVGDEVNWYLMGMGNEVDLHSVHFHGHSFQYQHRGVYTSDVFDLFPGTYQTVEMTPKTPGIWLLHCHVTDHIHAGMETTYTVLPNEGEYSLSDSRRNVLHNE
>sp|E1B8W3|E1B8W3_BOVIN Armadillo repeat containing 4 OS=Bos taurus (Bovine) OX=9913 GN=ARMC4 PE=4 SV=3
MGVALTRSAQWTAAGHGAKTLEVTPLNEAIVKEIIMFVESFIYKYPQEANYVFVEPLEWKTNLDPSAFGSGYAVSGTTVKSEEADKNGEPLLYLSVPQIKIRSFGQLSRMLYIAKNMKLKEAQACIEANRNPVAKILGLDYNIISEKIGNSFVSNILDKITKDDDSESEIKMKIALQLKQLDLHLLNHSLKHISLEIRLNPGTVKNDIELLKQFSGKGKQTVLESIEYTSDYEFSNGCRAPPWRQIKGEICYVLVKPHDAETLCVTCSKEGVFLNGGKTDDEGQINYERKGEIYKDLVTLLKEKSAIFSENMSKQEIKFSEQPQKDQPNEAPKEEVAITHKASVTSRKSTQEKNRINLGRSQLTKRLEPSLNWRTSVSSKDRNTLRDTQVEKHGGKLEKSRSSVSPGRAQLIRKSVEKIEEIISDSSSESEEDEEQPDHRQEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMKDFNLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPVMVNILDSPHKSLKCLAAETIANVAKFRRARRVVRRHGGITKLVALLDCGKHSGEPAQSSLYETRDVEVARCGALALWSCSKSYANKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQEHENRVIIRRCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIQNAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAVITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAETISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCVTMHENGAVKLLLDMVGSPDEELQEAAAGCISNIRRLALAIEKARYS
>sp|E1BHY6|E1BHY6_BOVIN Granulin precursor OS=Bos taurus (Bovine) OX=9913 GN=GRN PE=4 SV=3
MWTLVSWVALVTGLVVGTQCPDGQLCPVACCLDPNGATYSCCNPVQDQRPSVLSQRLGRPCQADGHCAPGYSCILTVSGTSSCCPFPEAVSCGDGRHCCPRGFHCNADGRSCFQRSDTKPLDAVQCPDKQFQCPNSSTCCTMPDGSWGCCPMPQASCCEDKIHCCPHGTSCDLARGRCLSATGTHPLAKKMPAHKTKSSVILCPDGQSQCPDGSTCCKLPTGKYGCCPMPNAICCSDHLHCCPQNTVCDLTQSKCLSKENATDLLTKLPAHTVQDVKCDMEVSCPDDYTCCRLQSGAWGCCPFVQAVCCEDHVHCCPSGFRCDTEKGVCEQGTRQMPWMKKAPAHLSLLDLGAVEGDVPCDNVTSCPSSTTCCRLKSGEWACCPAPEAVCCSDHQHCCPKGYTCVARRHCKRGKQVVTGLDKVPAHRASPSHPRDMGCDQHTSCPVGQTCCPSLRGAWACCKLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVDPVHPAVRLASGPPVGMGNVECGARHFCHDNQTCCPDSQGGWACCPYRKGTCCGDKHHCCPSGFRCAARGTKCLRREALRWDAPWRDPTPRQLL
>sp|F1MIE6|F1MIE6_BOVIN Fibronectin type-II domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=IGF2R PE=4 SV=3
MEAAAGRSSHLGPAPAGRPPRCPLLLQLQLLLLLLLLPPGWVPGAAGTQGAEFPELCSYTWEAVDTKNNMLYKINICGNMGVAQCGPSSAVCMHDLKTDSFHSVGDSLLKTASRSLLEFNTTVNCKQQNHKIQSSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKNIFKANKEVPCYAFDRELKKHDLNPLIKTSGAYLVDDSDPDTSLFINVCRDIEVLRASSPQVRVCPTGAAACLVRGDRAFDVGRPQEGLKLVSNDRLVLSYVKEGAGQPDFCDGHSPAVTITFVCPSERREGTIPKLTAKSNCRFEIEWVTEYACHRDYLESRSCSLSSAQHDVAVDLQPLSRVEASDSLFYTSEADEYTYYLSICGGSQAPICNKKDAAVCQVKKADSTQVKVAGRPQNLTLRYSDGDLTLIYFGGEECSSGFQRMSVINFECNQTAGNNGRGAPVFTGEVDCTYFFTWDTKYACVHEKEALLCGVSDGKQRFDLSALARHSELEQNWEAVDGSQREAEKKHFFINICHRVLQTGQARGCPEDAAVCAVDKNGSKNLGRFISSPTREKGNIQLSYSDGDECGGGQKIITNITLMCKPGDLESAPVLTTSRADGCFYEFEWRTAAACVLSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECIVTDPVTLDQYDLSRLAKSEGGPGGNWYSLDNGGARSTWRKYYINVCRPLNPVPGCDRYASACQMKYQGEQGSYSETVSISNLGVAKTGPMVEDSGSLLLEYVNGSACTTSDQRRTTYTTRIHLVCSTGSLYTHPIFSLNWECVVSFLWNTAAACPIRITTDIDQVCSIKDPNSGYVFDLNPLNNSRGYVVLGIGKTFLFNVCGDMPACGTLDGKPASGCEAEVQMDDMKTLKPGRLVGLEKSLQLSTEGFITLNYTGLPSHPNGRADAFIIRFVCNDDVYPGTPKFLHQDIDSSLGIRDTFFEFETALACVPSPVDCQVTDPAGNEYDLSGLSKARKPWTAVDTFDEGKKRTFYLSVCTPLPYIPGCHGTAVGSCLVTEDSKLNLGVVQISPQVGANGSLSLVYVNGDKCKNQRFSTRINLECAHTTGSPTFQLQNDCEYVFLWRTVEACPVVRAEGDYCEVRDPRHGNLYNLIPLGLNDTVVRAGEYTYYFRVCGELTSGVCPTSDKSKVISSCQEKRGPQGFQKVAGLFNQKLTYENGVLKMNYTGGDTCHKVYQRSTTIFFYCDRSTQAPVFLQETSDCSYLFEWRTQYACPPYDLTECSFKNEAGETYDLSSLSRYSDNWEAVTGTGSTEHYLINVCKSLSPQAGSDPCPPEAAVCLLGGPKPVNLGRVRDSPQWSQGLTLLKYVDGDLCPDQIRKKSTTIRFTCSESHVNSRPMFISAVEDCEYTFSWPTAAACAVKSNVHDDCQVTNPATGHLFDLSSLSGRAGFTAAYSEKGLVYLSVCGDNENCANGVGACFGQTRISVGKASKRLTYVDQVLQLVYEGGSPCPSKTGLSYKSVISFVCRPEVGPTNRPMLISLDKRTCTLFFSWHTPLACEQTTECSVRNGSSLIDLSPLIHRTGGYEAYDESEDDGSDTSPDFYINICQPLNPMHGLACPAGTAVCKVPVDGPPIDIGRVAGPPILNPIANEVYLNFESSTPCLADRHFNYTSLITFHCKRGVSMGTPKLLRTSVCDFVFEWETPLVCPDEVKTDGCSLTDEQLYYSFNLSSLSKSTFKVTRGPHTYSVGVCTAAAGLDEGGCKDGAVCLLSGSKGASFGRLASMKLDYRHQDEAVILSYANGDTCPPETEDGEPCVFPFVFNGKSYEECVVESRARLWCATTANYDRDHEWGFCKHSTSHRTSVIIFKCDEDADVGRPQVFSEVRGCEVTFEWKTKVVCPPKKMECKFVQKHRTYDLRLLSSLTGSWSFVHNGASYYINLCQKIYKGPQDCSERASVCKKSTSGEVQVLGLVHTQKLDVVDDRVIVTYSKGHYCGDNKTASAVIELTCAKTVGRPSFTRFDVDSCTYHFSWDSRAACAVKPQEVQMVNGTITNPANGRSFSLGDIYFKRFSASGDVRTNGDRYIYEIQLSSIMGSSSPACSGASICQRKANDQHFSRKVGTSNQTRYYVQDGDLDVVFTSSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSHETADCQYLFSWHTSAVCPLGAGFDEEIAGDDAQEHKGLSERSQAVGAVLSLLLVALTACLLTLLLYKKERREMVMSRLTNCCRRSANVSYKYSKVNKEEEADENETEWLMEEIQPPAPRPGKEGQENGHVAAKSVRAADTLSALHGDEQDSEDEVLTLPEVKVRPPGRAPGAEGGPPLRPLPRKAPPPLRADDRVGLVRGEPARRGRPRAAATPISTFHDDSDEDLLHV
>sp|F1MH27|F1MH27_BOVIN Chitin-binding type-2 domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=CHIA PE=3 SV=2
MAKLIFLTGLAFLLNAQLGSAYQLVCYFSNWAQYRPGLGSFKPDNIDPCLCTHLIYAFAGMSNSEITTIEWNDVALYSSFNDLKKKNSQLKILLAIGGWNFGTAPFTAMVATPENRKTFISSVIKFLHQYGFDGLDFDWEYPGSRGSPSQDKHLFTVLVQETREAFEQEAKQTNKPRLLVTAAVAAGISNIQAGYEIPQLSQYLDFIHVMTYDFHGSWEGYTGENSPLYKYPTDTGSNTYLNVEYAMNYWKKNGAPAEKLIIGFPAYGHNFILRDASNNGIGAPTSGAGPAGPYTREAGFWAYYEICAFLKDGATEAWDDSQNVPYAYKGTEWVGYDNVNSFRIKAQWLKENNFGGAMVWAIDLDDFTGTFCNQGKFPLINTLKDALGLKSATCNASTQSSEPNSSPGNESGSGNKSSSSEGRGYCAGKADGLYPVADNRNAFWNCVNGITYKQNCLTGLVFDTSCHCCNWA
>sp|G3MXG6|G3MXG6_BOVIN Ig-like domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000046076 PE=4 SV=2
QVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGGIDTGGSTGYNPGLKSRHTSISRGTSKNQSSLQLSSVTTVDTAVYYCARDTLRGPQCEPSHNWGLSTGTFPPLQAPSTVTPESFPVSEPGT
>sp|G5E513|G5E513_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000001219 PE=1 SV=2
SPSDESTVALGCLARDFVPNSVSFSWKFNNSTVSSERFWTFPEVLRDGLWSASSQVVLPSSSAFQGPDDYLVCEVQHPKGGKTVGTVRVIATKAEVLSPVVSVFVPPRNSLSGDGNSKSSLICQATDFSPKQISLSWFRDGKRIVSGISEGQVETVQSSPITFRAYSMLTITERDWLSQNVYTCQVEHNKETFQKNVSSSCDVAPPSPIGVFTIPPSFADIFLTKSAKLSCLVTNLASYDGLNISWSRQNGKALETHTYFERHLNDTFSARGEASVCSEDWESGEEFTCTVAHSDLPFPEKNAVSKPKDVAMKPPSVYLLPPTREQLSLRESASVTCLVKGFAPADVFVQWLQRGEPVTKSKYVTSSPAPEPQDPSVYFVHSILTVAEEDWSKGETYTCVVGHEALPHMVTERTVDKSTGKPTLYNVSLVLSDTASTCY
>sp|G3N3Q3|G3N3Q3_BOVIN Ig-like domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000046161 PE=4 SV=2
VTFICSKMNPLWTLLFVLSAPRGVLSQVQLQESGPSLVKTSQTLSLTCTASGLSLTRYGIHWVRQAPGKALEWLGDISSGGSTGYNPGLKSRLSITKDNSKSQVSLSLSSLTPEDSATYYCARDTVRGRQCEPRQKPPCIGARDHQGALRTQYRAEPWSRCRRGLGRWGVWGGFSSELLFPPPAQEPHL
>sp|F1N0R5|F1N0R5_BOVIN von Willebrand factor OS=Bos taurus (Bovine) OX=9913 GN=VWF PE=4 SV=3
MFPTRLARLLLAVALTLPGALCGEGALGKSSMARCSLFGADFINTFDESMYSFSGDCSYLLAGDCKTHSFSIVGDFQGGRRMGLSVYLGEFFDIHVFVNGTVLQGGQHVSMPYATRGLYLETEVGHHKLSSESYGFVARIDGSGNFQILLSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLTSDPYDFANSWALSSEEQRCPRVSPPSSSCNVSSELQKGLWEKCQLLKTASVFARCHALVDPEPFVALCERMLCACAQGLRCPCPVLLEYARACAKQGMLLYGWADHSSCRPDCPAGMEYKECVSPCHRTCRSLSITEVCREQCVDGCSCPEGQLLDEGRCVESTECPCVHAGKPYPPGASLSRDCNTCICRNSQWVCSNEDCPGECLITGQSHFKSFDDRHFTFSGVCQYLLAQDCQDHSFSVVIETVQCADDPDAVCTRSVTVRLPSPHHGLLKLKHGGGVALDGQDIQIPLLQGDLRIQHTVTASLQLNFGEDLQIDWDGRGRLLLKLSPVYAGRTCGLCGNYNGNQRDDFLTPAGLVEPLVEHFGNSWKLRADCEDLQEQPSDPCSLNPRLTKFADQACAILTSPKFEACHSAVSPLPYLRNCRYDVCACSDGRDCLCDAVANYAAACARRGVHVGWREPSFCALSCTHGQVYQQCGTPCNLTCRSLSHPDEECTEVCLEGCFCPPGLFLDETGSCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCSTSGAPGSLLPEAVLSSPLSHRSKRSLSCRPPMVKVVCPADNPRAEGLECTKTCQNYDLECMSTGCVSGCLCPPGMVRHENRCVALERCPCFHQGREYAPGDRVKVDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKYLFPGECQYVLVQDHCGSNPGTFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFDGEVNVKTPMKDETHFEVVESGRYITVLLGKALSVVWDGHLAVSVFLKRTYQERVCGLCGNFDGVQNNDLTSSSLQVEENPVDFGNSWKVSPQCADTQKVRLDSAPAICHDNVMKQTMVDSSCRVLTSDVFRECNRLVNPEPYLDVCIYDSCSCESIGDCSCFCDTIAAYAHECAQHGQVVTWRTATLCPQNCEERNLKESGYQCEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVNPEDCPVCQVEGRRLASGKKVTLNPGDPEHCQICHCDGVSLTCEACKEPGGPPPTEGPVIPTTPYVEDIPEPPLHDFFCSKLLDLVFLLDGSSKLSEADFETLKAFVVGMMERLHISQKRIRVAVVEYHDGSHAYLALQDRKRPSELRRIAGQVKYAGSEVASTSEVLKYTLFQIFGRIDRPEASRVALLLTASQEPPRLARNLVRYVQGLKKKKVSVVPVGIGPHASLKQIRLIEKQAPENKAFVLSGVHELEQRMDDIVGYLCDLALEVPAPTLTQHPLAAQVTVAPQLLGPSLPGPKRSSVVLDVAFLLEGSDEVGEANFNRSAEFVEEVIRRMDVGQDGIHVTVLQYSYVVTVEHSFREPQSKDVVLQRLREVRYRGGNQTNTGLALQYLSEHSFSASQGDREQAPNLVYMVTGSPASDKIQRMPGDIQLVPIGVGPRVDVQELERVSWPQTPIFIQDFERLPREAPDLVLQRCCSEDGPHLPTLAPAPDCSQPLDVVLLLDGSSTSPASYFDEMKSFAKAFISKANLGPQLTQVSVLQYGSNTNVDVPWDIHVDKAHLLSLVDPMHREGGPSQVGQALSFAARYITSQVHGARPSASKVVVILVTGSSMDSVEAAAAAARSNRVAVFPIGIGDQYDAAQLRVLAGPGASSNVAELQRIEDLPSMVALGNSFFQRLCSGFVSVCVDEDGNERRPGDVWTLLDQCHTVTCLPDGQTLLKSHRVNCDQGPQPSCPDGQTPLRMEEACGCRWACPCVCTGSSTRHIVTFDGRNFKLTGNCSYVLFHNKEQDLEVILHNGFCSAGARQACMKSVEVKQNGLSVELRSNMEVMVNGRLVSVPYLGGDMEVRVYGTIMFEVRFMGHILSFTPQNNEFQLQLRPKIFASKTYGLCGFCDENGANDFMLRDGTVTEDWKTLVREWTVQQPGQTCPLGPEEPCPISQGSRCQVLLSELFAECHKVLAPATFHAMCQQDSCQQEQVCEAIASYAHLCRTKGVCVDWRTPDFCAVSCPPSLIYNHCESGCPRQCEGNSSSCGDHPLEGCFCPPHQVMLEGSCVPEEACTQCVGDDGIRHQLLETWVPDHQPCQICTCLSGRKVNCTTQPCPSAGVPTCGPCEVARLRQSTQQCCPEYECVCDLVSCDVPPVPNCEDGLQPVLANPGECRPSFTCVCRKEECPKGSPPSCPPHRMPALRKTRCCDEYECACNCTNSTVSCPLGYLASTITNDCSCTTTTCLPDKVCVHRGTIYPVGQFWEEGCDTCTCTDLEDAVMGLRVAQCSQKPCADICRPGFTYVLREGECCGRCLPSACEVVTGSPRGDSQTQWKSVGSHWASPENPCLIHECVRVEEEVFVQQRNVSCPQLNVPVCPLGFQLRCQTLGCCPTCRCEPVQACVLNGTIIGPGKTVMVDACMTCRCHVQAGVISGFKLECRKTTCQACPAGYMEEKLQGECCGRCLPTACTIQLRGGQIMMLKRDETLQDGCDSHFCKVNKRGEFIWEKRVMSCPPFNEHKCLAEGVSRRKQVPSLTCPVGEEPECKDITARVKSIKVGDCKSEDEVDIHYCQGRCTSKALYSIDTEDVQDQCSCCSPTRTEPMPVPLRCTNGSIIHHVVLNALQCQCSSRKCSP
>sp|F1MTT3|F1MTT3_BOVIN Coagulation factor XII OS=Bos taurus (Bovine) OX=9913 GN=F12 PE=3 SV=2
MRALLLLGALLVSLESTVSTPPWKGPKKHKLTESEHTVVLTVTGEPCHFPFQYHRQLHHKCTHRGRPGPRPWCATTPNFEKDQRWAYCLEPKKVKDHCSKHNPCQKGGTCVNMPDGPRCICADHFTGKHCQKEKCFEPQFFRFFHENEIWHRLEPAGVVKCQCKGPNAQCKPLASQVCRTNPCLNGGSCLQAEGHRLCRCAPSFAGRLCDVDLKASCYDDRDRGLSYRGMAGTTLSGAPCQSWASEATYWNVTAEQVLNWGLGDHAFCRNPDNDTRPWCFIWKGDRLSWNYCRLAPCQAAAGHEHFPLPSPSALQKPESTTQTPLPSLTSGWCSPTPLASGGPGGCGQRLRKWLSSLNRVVGGLVALPGAHPYIAALYWDQHFCAGSLIAPCWVLTAAHCLQNRPAPKELTVVLGQDRHNQSCEQCQTLAVRDYRLHEAFSPITYQHDLALVRLQESADGCCAHPSPFVQPVCLPSTAARPAESEAAVCEVAGWGHQFEGGEYSSFLQEAQVPLIDPQRCSAPDVHGAAFTQGMLCAGFLEGGTDACQGDSGGPLVCEDETPERQLILRGIVSWGSGCGNRLKPGVYTDVANYLAWIREHTAS
>sp|F1MVP0|F1MVP0_BOVIN Peptidase M12B domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ADAMTS13 PE=4 SV=3
MHTAAAAKLLQSSLPAPSPGRPLAPRLRRRAAGHVLHLELLVAVGPDVHRTHGEETERYVLTNLNMGSELLRDPSLGAQFRVHLVKMVILTQPEDAPEITANITASLLSVCEWSRTVNPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGLTIAHEIGHSFGLEHDGVPGSGCGPSGHVMASDGAAPALALGGPAWSPCSRRQLLSLLSAGRARCLWDPPGPLSGPAGQPPEVQPGLYYGADEQCRVAFGPTAVACTFRGEHLDMCQALSCHTDPLDPSSCSRLLIPLLDGTECGVGKWCSKGHCRSLAELAPVGVVHGHWSGWGPASPCSRSCGGGVITRRRRCNNPRPAFGGRTCVGSDLQAEMCNTQACEKTQLEFMSEQCAQTDSEPLRLSPGGSTAFYRWGTAEQYSEGNALCRHVCRAVGESFMVRRGDRFLDGTRCVPGDPQEDGALRLCVSGSCRTFGCDGRMDSGQVRDVCQVCGGDNSTCQPQSGSFTAGRAREYVTFLTVTPNLTSIYIINRRPLFTHLAVRVRGRYVVAGNGSASASTSYPSLLEDNRVEYRVTLSEDRLPRREEIRIRGPTRDDMEIQVYRRYSEEYGSPARPDITFIYFQPEQRRAWAWVPVQGPCSVSCGAGLRQVTYRCRDQSRSEWVEAAHCAGSQPPVAWSETCTPGPCPPHWEAGDFGPCSASCGGGLREREVRCVEARGGLLRTVPRSRCRALAPQPAAVDTCNSQPCPQRETDACSSACGADPAVQNTTCVPGSDGTGLLVTAGPCSADEKPPAPEPCVEATCPPGWDQVKTGAPMVLADPLLGVRGSSFLPAGLVELRFVCMDTALRTPVREELCDLASKPGSRREACQAAPCPARWETRALAPCPVTCGGGQVPLAVRCVRMDQGRLVSLPHSKCWPMPRPRTLEDCSLEPCPARWAPP
>sp|F1N3Q7|F1N3Q7_BOVIN Apolipoprotein A-IV OS=Bos taurus (Bovine) OX=9913 GN=APOA4 PE=3 SV=2
MAWTWGYPIPSEQPGSPGRGCGDTGSQDQPSCGLFQWQITEAHPRAGHGIHGGQPTVQYDGCRLLVTQGRIWCSKRLSQPSEEPRMFLKAVVLSLALVAVTGAEAEVNADQVATVIWDYFSQLGNNAKKAVEHIQKSELTQQLNTLFQDKLGEVSTYTDDLQKKLVPFATELHERLTKDSEKLKEEIRKELEDLRARLLPHATEVSQKIGDNVRELQQRLGPYAEELRTQVDTQAQQLRRQLTPYAERMEKVMRQNLDQLQASLAPYAEELQATVNQRVEELKGRLTPYADQLQTKIEENVEELRRSLAPYAQDVQGKLNHQLEGLAFQMKKHAEELKAKISAKAEELRQGLVPLVNSVHGSQLGNAEDLQKSLAELSSRLDQQVEDFRRTVGPYGETFNKAMVQQLDTLRQKLGPLAGDVEDHLSFLEKDLRDKVSSFFNTLKEKESQAPALPAQEEMPVPLGG
>sp|E1BH94|E1BH94_BOVIN Peptidoglycan recognition protein 2 OS=Bos taurus (Bovine) OX=9913 GN=PGLYRP2 PE=4 SV=3
MSFGNWKPTVVVQGILWILYGLLLQPEPGTATLPLLMDSVIQALAELEQKAPATEAGHSAAAWLLTAQGSGTHSPLYHFLLEGKSLNTTELDPPSLSPELRGLMGEVARHSVQDGKEYGVVLAPDGSTVAVEPLLAGLWAGLQGHRIVNLSLESTATPPDAGVTFPDLGPTSPGLSDASPDVTSGDVRAVSPNVSTKDTDVRATSPEVRPGSPDVQASSPDTKAKLPTAVDSLLVVTLARGLGLNFLQGPQTWNHSGLGTEGCWDQLSVPRTFTLLDPEASPLTTAFLNGALDGALLGDYLSRTPAPRPPLSHLLSQYYGAGVAGDPGFRSNFRRHNGAALTSAPSLTQQVWGALILLQRLEPAHPHLQGMSQEELAQVATHATKEFTEAFLGCPAIHPRCRWGAAPYQGRPTLLKLPLGFLYVHHTYLPAPPCTSFESCAADMRSMQRFHQQTRGWSDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVALIGNYTAVLPSEAALLAVRDELPRCAIRAGLLRPDYALLGHRQLVPTECPGDLLFNLLRTWPHFDKNVKPRTARRASSRSKRRPPPTILLSTDLQ
>sp|F1MBC5|F1MBC5_BOVIN Coagulation factor IX OS=Bos taurus (Bovine) OX=9913 GN=F9 PE=3 SV=3
MWCLNMIMAESPGLVTICLLGYLLSAECTVFLDRENATKILHRPKRYNSGKLEEFVRGNLERECKEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGMCKDDINSYECWCQAGFEGTNCELDATCSIKNGRCKQFCKRDTDNKVVCSCTDGYRLAEDQKSCEPAVPFPCGRVSVSHISKKLTRAEIIWDNVTQSNQSFDEFSRVVGGEDAERGQFPWQVLLHGEIAAFCGGSIVNEKWVVTAAHCIKPGVKITVVAGEHNTEKPEPTEQKRNVIRAIPYHSYNASINKYSHDIALLELDEPLELNSYVTPICIADRDYTNIFLKFGYGYVSGWGKVFNRGRSASILQYLKVPLVDRATCLRSTKFSIYSHMFCAGYHEGGKDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
>sp|F1MER7|F1MER7_BOVIN Heparan sulfate proteoglycan 2 OS=Bos taurus (Bovine) OX=9913 GN=HSPG2 PE=1 SV=2
VTHGLRAYDGLSLPEDAETVTAGRAGWSYSDLSDDEDFLADEASGDGVGSGDLGSGDFQMVYFRALVNFTHSIDYSPQLEDAGSEEFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEVLHGVISSGSIASYVTSPQGFQFRRLGTVPQVPRACTEAEFACHRYNECVALEYRCDRRPDCRDMSDELDCEEPMPTLSSQPPPLGATPPPPAQPESLPSQQRPATPAPQAALPSPGRPVPCGPHEAACHSGHCIPKDYVCDGQEDCADGSDEADCGPTPPCEPNEFPCGNGHCALKLWRCDGDFDCEDHTDEADCPVKRPEDVCGPTKFRCVSTNTCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQELIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLTIHDVKEADQGAYTCEAMNARGMVFGIPDGVLELIPQRGPCPDGHFYLEHSASCLPCFCFGVTNVCQSSRRFRDQIRLRFDQPNDFKGVNVTMPAQPGMPPVSSTQLQIDTTLQEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYKVRYELARGTLEPVQRPDVVLVGAGHRLLSRGHTSTQPGVPNQRQVQLSEEHWVHESGRPVQRAEMLQVLQSLEAVLIQTVYDHKMASVGLSDVAMDTTVTYATSHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAAGYEGNPIQPNGKCRPINQQIVRCDERGSTGSSGEACLCKNNVVGRLCNECVAGSFHLSARNPDGCLKCFCMGVSRQCTSSSWRRAQVLGASEEPTRFTLTNPTGTHNASEGISSPSPGELVFSSFHSLPPGPYFWSLPPHFLGDKVTSYGGELRFTVTQRPQPGSAPLPGQPLVVLQGNNIVLEHHTSQQPSSGQPSTFTVPFWEQAWQRPDGQPATREHLLMALADIDSLLIQASHTQRPAESRVSGISMDVAVPEDTGQDPAREVEQCACPPGYRGPSCQDCDAGYTRMPSGLYLGTCERCSCHGHTEVCEPETGACQECQHHTEGPRCEQCQPGYYGDAQRGTPHDCQPCPCHGAPAAGQSTHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCRRSGGQLPEQIGCGCDPQGSVSNQCDPAGQCQCKAQVEGLTCSQCRPHHFHLSASNPDGCLPCFCMGVTQQCASSSYTRQLISTRFAPGDFQGFALVNPQRNSRLTGGFSVEPVPEGTQLSFGNFAHLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGAQGSPLSDPDAGRRGGNNIMLVASQPALQGPERKNYEVVFQEEFWRRPDGQPATREHLLMALADLDELLVRATFSSMPLAASISGVSLEVAQPGPSEGPRALEVEECRCPPGYVGSSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHPETGACSQCQHHAAGEFCEQCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYVGNPNVPGGRCLPQADQAPLVVQVHPTRSVVPQGGPHSLRCQVSGSPPHYFYWSREDGRPLPSSTQQRHQGSELHFPSVQPSDAGVYICTCRNLHHANTSRAELLVTEAPGKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQASATPSAPVVSIHPPQLTVQPGQMAEFRCSATGHPMPSLEWTGGPGGQLPQKAQVHRGILRLPAVEASDQGQYLCHAHSSAGQHVARAVLHVHGGNGPRVQVSPERTQVHEGRTVRLYCRAAGVPSATITWRKEGGSLPPQARAERTDIATLLIPAITAADAGFYLCVATSPAGTAQARIQVVVLPGATTPPVRIESSSPSVTEGQTLDLNCVVAGLAHSQITWYKRGGSLPPHAQVRGSRLRLPQVSPADSGEYVCRVENDSGPKEASIIVSVLHSRHPGPGYTPAPGGTQPVRIEPSSSHVAEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCRVVLGSGPLETSVLVSIEASDAGTIPAPGPVPPVRIESSSPTVAEGQTLDLNCVVAGQAHAPVTWYKRGGTLPARHQVRGSRLYIFQASPADAGEYVCRASNGVEASITVTVTKTQGANFAYPPGGTQPVRIEPSSSHVAEGQTLDLNCVVPGQPHAQVTWHKRGGSLPARHQTHGSLLRLYQVSPADSGEYVCRVVGGSVPLESSVLVSIEPVDSVPALGVTPPVRIESSSSHVAEGQTLDLNCLVSGQPHAQVTWHKRGGSLPARHQVHGSRLRLPQMTPADSGEYVCRVVSGSGTQEASVLVTIQQRRGPTRYQNVVYPVRIESSSDSLANGRTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSQETSLIVTIQGSDSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVAGQPQATITWYKRGGSLPARHQAHGSRLRLHQMSVADSGEYVCRANNNIDALEASIVVSVTPGTGGPSGPSGTMPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGSLPAHHQTHGSRLRLHRVSPADSGEYVCRVALGSGPLEASVLVTIEASGSGSVVVPAPGGAPPIRIETSSSHVAEGQTLDLKCVVPGQAHAQVTWHRRGGSLPARHQVHGPLLRLNHVSPADSGEYSCQVSSSSGTLEASVLVTIEASSPSPIPAPGLAQPIHIEASSSHVTEGQTVDLNCVVPGQAHAQVTWHKRGGSLPTRHQTHGSRLRLHHVSQSDSGEYVCRVVGGSGSEQEASFTITVPPSAGSSYRLRSPVISIDPPSSTVQQGQDASFKCLVHDGAAPISLEWKTRNQELEDNVRISPNGSIITIVGARPSNHGAYRCVASNAYGVAQSVVNLSVHGPPVVSVLPEGPVRVKLGKDVTLECVSSGEPRSSARWTRIGAPTHLEQRAHGLLDSHTVLQISSAKPSDAGTYVCLAQNALGTAQKRVEVIVDTGAVAPGAPQVQVEEVELTVEAGHTATLRCSATGSPKPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNASSPAGHAEATVVLHVESPPYATTVPEHASVRAGEAVQLQCLAHGTPPLTFQWSRVGGHLPAGATARNELLLFEAAAPEDSGRYRCQVTNRVGLAEAFAQVLVRGPSGSLPATPAPAGSAPTVQVTPQLETKSIGASVEFHCVVPSDPGTQLRWVKEGGPLPPGHSVHDGVLRIQNLDQNCQGTYVCQAQGPWGQAQASAQLVVQALPSVLINIRTSVQSVVVGHAVEFECLALGDPKPQVTWSKVGGRLRPGIVQSGGIVRIARVELADAGQYRCTATNAAGTTQSHVLLLVQGPTEVPAAAGLTVLVCLQLDGNLPPDSRLENHMLLLPSVQPQDAGTYVCTATNRQGKVKAFAQLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKQIPGSPANLANRQPDFISFGLVGGRPEFRRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGSLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCQDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGHGYTCRCHLGRSGMRCEEGVTVTTPSLSGTDSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHHVSAERLNKDGSLQVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPAVQLPPATNVSAHFHGCVGEVSVNGKRLDLTYSFLGSQGVGQCYDSSPCERQPCRHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLHEPCLHGGTCQGTHCLCPPGFSGPRCQHSSAHGLVESDWHLEGSGGNDAPGQYGAYFYDNGFLALPGRIFSRSLPEVPETIELEVRTSTASGLLVWQGEETGQSGRGKDFISLGLQDGHLVFSYQLGSGEARLVSEDPINDGEWHRVTALREGQRGSIQVDGEELVSGQSPGPNVAVNTKGSIYVGGAPNVAVLTGGRFSSGITGCIKNLVLHSARPGGPPPQPVDMQHRAQAGANTRPCPS
>sp|E1BMG2|E1BMG2_BOVIN Dynein axonemal heavy chain 5 OS=Bos taurus (Bovine) OX=9913 GN=DNAH5 PE=4 SV=3
MAESYRNFYVRWKPSQRLKEEKEAKRARLDGRHDYLFGIVASCVDLNKTEVEDAILEGNQIERIDQLFAAGGLRHLMFYYQDVEVVETGQLGSPGGVNSVSGKMKKPKVFVTEGKDVALTGVCVFFIRTNPARAITPENIHREVSFNMLDTADGGLLNSMRRLLSDIFIPALRATSHGWSELEGLPEASSLRQEFLGSLEGFVSILASAQESLKEKVNLQKCDIFELKTLKEPIDFLTLANNPETMEKIEGCMKVWIKQTEQVLAENNQLRKEADDLGPRAELEYWKKRLSKFNYLLDQLKSPDVKAALAVLAAAKSKLLKVTWRETDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPISMIDAIPTLVNAIKMIYSISHYYNTSEKITSLFVKVTNQMISACKAYITNNGTASIWSQPQDVVVEKILSAIKLKQEYQHCFHKTKQKLKQNPSEKQFEFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIEGLENMITKYQGIVATIKKKEYDFLDQRKMEFEQDYEEFCKQINDLHVDNKYVSVCFKISLNRQKLNIPNLGIDDKYQRILENYGADIDMISKLYTKQKNDPPLARDQPPIAGKILWARQLFHRIQQPMQLFQKHPSVLRTAEAKPVIRSYNRVAKVLLEFEVLYHRAWLQQTEEIHVGLEASLLVKAPGTGELFVNFDPQILTLFRETECMSQMGLQVSPFAAALFQKRDTYKKNFSNMKMMLAEYQRVKSKMPAIIEQLMVPHLAKVDEALQPGLAALTWTSLNIEMYLKNAFAKIRDLELLLDRVNDLIEFRIDAILEEMSSTPLCQLPGEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELINMLLDVEVPSKEEREKVFNVNSDDWKNESSGKRKEENSDALTSSLNAGAGLLPLMTISRKKKEIEVLEEGARELLCHFNHQNTDALLKVTRNTLEAVRRRVQFCNVTSFRDSNSASKVKQNGLPIFRASITLAIPNISMAPALEDIQQTLNKAVEFIVTVSKGVRQWSDEPVSKKKMQERKLTALQHNEDSDSDIEMGENEPQDTLEIASVNLPIPVQTRNYYKNVSDNKEIVKLVSVLSTIINSTKKEVITSMECFKRYDHIWQKEKEETIMTFIIKNPSLSEFESQILYFQKLEQEINAEPEYICVGAIALYTADLKFTLTAETKAWMVVIGRHCNQKYRSEMENIFTLVEEFNKKLNRPIKDLDDIRIAMAALKEIREQQIAIDFQVGPVEESYTLLNKYGLLIAKEEMDKVDALRYSWEKLLARASEVQNELVSLQPGFRKELIGTVEVFLQDCHQFYQDYDVNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPVTQYPKLLEIKKQLNLLQKIYTLYNSVIDTVNSYHDILWSEVNIEKINGELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEHMASKAMMERHWERIMAVTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQQWVQHLSNSADIIESWMMVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDPHTIQAHLLNVFDNIKTVKFHEKIYDRILSISSREGETVELHKPVMAEGNVEVWLNSLLEESQASLHLVIRQAAANIQETGFQLIEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQSFLELLTTLIDMTTKDLSSVERVKYETLITIHVHQRDIFDDLCHMHIKSPSDFEWLKQCRFYFNEDSDKMMVHITDVPFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKERKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEMAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRALTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRLPQEAEILRQLYTKSFPDLYRFSIQNLEHQMEMLEAFVVLQSINMLQGLIPPKEQGGEVTAEHLGRLYVFSLMWSVGAVLEPDGRRRVEQWLRSREMLALDLPPLEGPDDSMFDYYVGSDGKWMHWNTCTEEYVYPSNTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPESHVIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTIFIDDVNMPVINEWGDQVTNEIVRQLLEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASVDKIFGVIGVGYYCTQRGFSEEVRDWVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRIWQGMLNTTPEVIKEPDELLRLWKHECKRVIADRFTASDDVTWFDKTLVSLVDEEFGEEKKLLVDCGTDTYFVDFLRDAPEATGETSEEADAEMPKIYEPVESFDHLKERLNMFLQLYNESIRGAGTDLVFFADAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKTLYRTAGRQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLITVMKKEYPRRPPTNENLYEYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSAYDIDCSLETKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVQTLANRMNTGLEKLKEASESVAALSRELEVKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNAVKIDLEKSCTVPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMADYNIETAKRVCGNVAGLCSWTKAMASFFSINREVLPLKANLVVQENRYMLAMQDLQKAQAELDNKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQAASALIGGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLNDWQKEMKAREIPFGDNLNLNEMLIDAPTISEWNLQGLPNDDLSVQNGIIVTKASRYPLLIDPQTQGKIWIKNKENQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEIDVMDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRKMKELEDNLLYRLTSTQGSLVEDESLILVLSKTKKTAEEVTQKLEISAETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYTARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGQKYAEAVILDLERTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETEFVHDSFRLWMTTEVHKQFPITLLQMSIKFANEPPQGLRAGLKRTYGGVSQDLLDVSAVAQWKPMLYAVAFLHSVVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDLKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTLAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQGLPTYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAMVARLADDMLEKLPPDYGPFEVKERLQMMGPFQPMNIFLRQEIDRMQRVLTLVRSTLTELKLAIDGTIIMSENLRDALNCMFDARIPARWKKASWVSSTLGFWFTELIERNCQFTSWVFNDRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDRRNMKLIESKPKVLFELMPVVRIYAENNAVRDPRLYSCPIYKKPVRTDLNYIAAVDLRTAQAPEHWVLRGVALLCDVK
>sp|F1MQ21|F1MQ21_BOVIN IF rod domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=NES PE=3 SV=3
MEGCLGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQAGDTSWRARADDELAALRALVDQRWREKHAAEVARDNLAEEVEGVASRCQQLRLARERTAEEVARSRRAVEAEKCAQAWLSTQAAELERELEALRVAQEEERAGLNAQAACAPRGSAPPRGPPAPAPEVEELAQRLGEAWRGAVRGYQERVAHMETSLGQARERLGHAMQGAREGRLELQQLQAERSGLQERRAALEQRLEGRWQERLRTTEQFQLAVEALEQEKQGLQSQIAQVLEGRQQLAHLKMSLSLEVATYRTLLEAENSRLQTPASGSKASLSFLDPKLELHFPGTPEGRRPGPLLSVLSPTPLSSPLPGTLETPVPTFLKSQEFLQARTPTSASTPIPPTPQAPCPAVDAEIRAQDAPVSLPQARVGRQQVPEVMWAEAKVAIPASVLPGPEEPGGQQQEPSPSQSPEDHASLAPALSPDHSSLETKDGEPSASRESSRSQEEDEGQLWGLTEKETVVEAKAVSSLQQETCQEEAGLDVKEIQDAQGPLEKEALNSLEEEIQKPSIPLEKQSHETIRSLEKENLESLRSLEEENLETLKILEKENQELLKSLEGKETEVMRSLEKETLELLKPIGKEDPQTLPSLGKENQEIMRSLEVNVETFLYPGKENQELVRSLEEENAESLRTLEKESQEPLRCQEVENQGTLRLLAKDNQEPLRSLEEEDQETSRPLGKENHESLRAPEDENHEALRPLERDKPESLSSLEEDQEAVRPPEREDQELLRSLEKEDQEPLRSLEEDQEAVRPLEEENQELLRSLEKEKEESLRSLEDQEAMRPLEEENQEPLRSLEDQEAMRPLEEENQEPLRSLEKEKQEATRPPEEEKQEPLMSLEEDQEEMRALEEDQETVRPLEKEKQESLRSLEDHEAMRPLEEENQEPLRSLEKEKQEVMRPPEEEKQELLRSLEDQEAMRSLEEEGQMTLSPLEKVKPETLKSLGKDQEIVRPLEKENQELLRSLNEKSTEAVRSLETETPEPLKPTEEENLEILKPLEKESQEPLGSVEGNHETLRPPEKENQESLGSLAEWNVENLQSLEEADKGSLRHLEEEEDVEQEESQASLRPLEEQGQELPLSAQQQKWGDAMQGDQELDQERPPGRAGVDSGDGAELELKELDSSPAEGEVVEQGQLQLTATGEAWGPGEGQPGSPEPKEQRLPAEGAGGAGGAAGLQDPEEQPEQVGALGLPAAQGTSEVMEPELEDEDVAPGGGRASPEVTLELERAMGRSEGVERGPEQEAVKLEDPGGLAREEVMEPPLGEGGMAAKKVQGLEGPRKELEEAGTLEPESGKSRDPLETPRDWEESESGALGKTEEPVSAETLWSHEGSDTLQPRPLGSEGAEEDAKPLLGPPSLRPTESCLPSLIPEDAPGPQPLAEGNQEASWGLEGRAEVVGKAGGEQEDLGSGGIPEGLQEEGEESREESEADELGETLPDSTPLGLYLRSPASPKWDLPGEQRPSPQGEPRKEGWDPVVPASKSLGAQPSEEEEEEGAEEEERGHDSELSEEFEDLGTEASLLPGVPGEGEEPLSQVPQLLLEPAAWDRDGESDGFADEEESGEEGEEEDEEEGREPGPGHWGPAPSVGSLPALSGPQGGHLLESETVGVSVPWDDGPRGAAADAPVTALETESQNSTEASGSEEESDAAPLETEDQVPGPLGTLSGVEDTLDGGPGPSLKEELERMNGGVVNGLEQSEGGGQGKPGAAGGDRGSPSEEEGASLKAPWAGAPLHLGQGQFLKFSQREGDGDSWSSGED
>sp|G3N369|G3N369_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=LOC539166 PE=4 SV=2
MAFRDVAVDFTQDEWVLLSPAQRSLYREVMLENYSNLVSLGIPFSKPELITQLEQGKETWREERKCSPVSCLEPKPELHLCPFCPPDLCSQKFHMQQVLCSPPPWIFTCLYAEDPVQPGDLCLEDQQQQAAGGSAWIEEVEGQEGEGARPLFGKTEKSTVEAFPRPPQRQPVISGGGVPGMEIEAGPAQMGTPEETDRLLKRIEVLGFGTVNCGECGLGFSKKTNLLSHQRIHSREKPYVCGVCGKGFSLKRSLDGHQNAHSGEKPLVCGECGRGFKQRSKLIIHERRHSGEKPYMCGECGRGFSDKSNLIVHQRTHSGEKPYVCQECGKGFSQKSAVIRHQTTHLKEKTVVCGNCGLGFSDRSNLIKHQRTHTREKPYACKECGWCFRQRSTLVNHQRTHSKEKPYVCGVCGHRFSQNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNTHSGHKPIVCKDCGRVFSQQSNLIRHQRTHSGEKPLVCVECGRGFSQKSNLVEHQRTHSGEKPYVCRECGRGFRHQSALIRHCSTHTREQPFNCRRCGRGFGNKSALLMHKWSHLEENSFLCTECGQGFSHKKHLILHQMTHQGRTPHMCKGCGQGFIQKSHLNRHRRNVCRPQNTISV
>sp|F1MPF0|F1MPF0_BOVIN Alpha-type protein kinase domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=TRPM7 PE=4 SV=3
MSQKSWIESTLTKRECVYIIPSSKDPHRCLPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQTLEEWSVEKHTEQSPTDAYGVINFQGGSHSYRAKYVRLSYDTKPEIILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTVNQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQSEAVHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRVDIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLVRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNTSSSTPQLRKSQESFGNRADKKEKTRHNHFIKTAQPYRPKIDTAVEEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILMLEYKTKAEMSHIPQSQDAHQMTMEDSENNFQNIAEEIPMEVFKEVRLLDKNEGKNEMEIQIKSKKLPITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVQMERLPSVQEWIVIAYIFTYAIEKVREIFMSEAGKISQKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFENAYDNHVFVAGRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPREAPSWTLAKDIVFHPYWMIFGEVYAYEIDVCANDSSISHICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLFCCICKRRKKDKTSDGPKLFLTEEDQKKLHDFEEQCVEMYFNEKDDKFHSGSEERIRVTFERVEQMCIQVKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKVHNEITRELSISKHLAQNLIDDGPVRPSVWKKHSVVNTLSSSLPQGGLESNNPFLCNIFMKDEKDSQCNIFGQDLPVIPQKKEFNFPEAGSSSSALFPSAVSPPELRQRIHGVETLKMFSKNQKPGSSSNSIPHLSSPPTKFFVSTPSQPSCKGHLETVTKDQETVCSKAAEGDNIEFGAFVGHRDSMDLQRFKETSNKIKEMLSNDIPSENTLKHVSSHAGFTECHKTSIPLHSEQVESSSRRSSAEETHEVDSKAALLPDWLQDRPLNREMPPEEGTLNGLASPFKPVMDTNYYYSAVERNNLMRLSQSIPFTPVPPRGEPVTVYRLEESSPNILNNSMSSWSQLGLCAKIEFLSKEEMGGGLRRAVKVQCTWSEHDILKSGHLYIIKSFLPEVINTWSSIYKEDTVLHLCLREIQQQRAAQKLTFAFNQMKPKSIPYSPRFLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIPTNTLEEIMLAFSHWTYEYTRGELLVLDLQGVGESLTDPSVIKAEEKRSCDMVFGPANLGEDAIKNFRAKHHCNSCCRKLKLPDLKRNDYTPDKIIFPQDEPSDLTLQPGNSTKESESTNSIRLML
>sp|E1BIP6|E1BIP6_BOVIN Glutaredoxin-like protein OS=Bos taurus (Bovine) OX=9913 GN=C7H5orf63 PE=3 SV=2
METCQTSWPLCHSWTPRSTSEVFKFHYRLAAYCSYYKEQSLGHISLLIYFSLGRIKMLWFQGNSMQLAKHSFLLLLRNLSASKTALPVLTLFTKDPCPLCDEAKEVLEPYRNRFILQEVDITLPENSAWYDRYKFDIPVFHLNGQFLMMHRVNLSKLEKQLQKLEQQGAGG
>sp|E1BPF2|E1BPF2_BOVIN Treslin_N domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=TICRR PE=4 SV=3
MACCHNVMLLLDTAGGVAGESLVRRAALRLLTYLSCRFGLARVRWAFRFFDSQGARSRPSRVSDFRELGVRSWEDFEEELEARLGDGAQGAHLPGPAPRASHTHSALMETLLDYQWDRPEITSPTKPILRNSGRRLLDVEGEAREAESALGGFVNAVFLLAPCPHSQRELLQFVSGSEAQAQRLPPTPKQVMEKLLPRKVQEVMRTRKITLYWVDTTEWPKLWESPDHLGYWTVCELLYHVGGTVLPFESFSQDFTKAGETLLSGERKLSSKPHLSSWISTLPTDSTLNCLLYNSPEYEASFPRIEGTLFFPVEGKELQETWTVTLEPLAMHQRHFQKPVRIFLKGTVTQWSLPTSGTLGTDSWMLQSPDGDRSTQRMLFQHLVNRLTAEELHLVASVDPGEGWPPITGVISPFSVGATVLTLFCTRETESQRHLLQTVVAESPQDSAALFSEVVDGVLKQIDSSLEVPATSDLPVPEWAQQELGRSAPWTSAIVEKWFPCSNLSGASSSLMESFWLLQATSSAKEEPSKTESDLTRGLSELYQRKSREEYSVSSQEDSRKKRGVPRTPVRKKMNTMCRSLKMLNVARLNVKAQKLHPDGSPDTAGEKGIQKTANGRTADRLENRGRTLRSSKPKDFKTEEELLSHIHENYQKTVAAGDTMLYSCARSTISNIKAFLKSKGTKELEEASLEMNCLYQVRNNFLKTSKSLRQNVGKLDKEGKVRECQLQVFLRLELCLQCPSVHERVEDLEQVVGEVTDLLRMLCLTEDSAYLAKFLEGILELYIDSIPKILGSLYDSLGFVIPQKLAGVLPADFFSDDSMTQESKSPLSVPLPSNAHRSLPGGTESDQLEELRTRSAKKRRKNAIRHKSIAEVSQNLRQIEIPKVAKRATKNENSHPTLQQQPPLPVKDTVQEVTKVRRNLFNQEMISPSKRSVKKGLPRSHSVSAVEGLEYKRDSFKRTKGYRKLLTKSVAETPVHKQISGRLLHRQIKGRSSDPGPDIDVVEESPEKGEDVVSLRRSPRIKQLAFSRTNSASFYSVSQPKSRSIQRVHSFQQMKSDQRENSPVQSIRSPKRLLFGAMSEMISPSEKGSARIKRPSGNTVGSATPTAYQTPEKSYWKSPSSCKATPRKVPRTPQTPLRTPERLQKSPAEMTPAKQVIFKEFLKDLSPHGWDSPSQPKVTPRKGHSLAEGASSLEKVRRTPQRQSGQPPRFLQNSSWPHLVDSSPESTSCPAALVSSTAPTRTECLTPNRSSARAPPRTAASGLQRQAASKGTSPSQKHQLPQGSGAPRAEKLPQLWSNKAVKTPERPGNAALTFPKRAVTSLSCGISKESSLGEFPIASLSSGQGGWQEVQRSPSVTTPPSCSAPLTPPSASQVAPSDLWPPPPPSKHGKRHNKTSETEQDFLEGQPDSLAALRVAITDNPAAITDTGKNQKAATLSSPASPELPAYPGTGFGGDWHTSSPLLIATDSDCLTLLDEAEHHGHDNLKSSISPLDGGEGLRMGTCEKPSPCDPRILPTSPSSGPHSPLMPLYDPHCTADMKQCQAATQLEDQQAAPWPCGAPASPQTYEVELEMQASGLPKLRIKKIDSSSLPEVEPPPREESSLPGPSVPRASKSSGKPEATCLSAPCLRPSHSTPGKSGGQTYICQSCTPTHCPCGTPSPFQTEVGVPWTPSPKHSGKTTPDTIKDWPRRKRAVDCSLGPSAGRSEVSSDLPGGVLPLEPEGKERGLELGIGRPPILGDFELEGVCQLPDQSPPRDSVPKAEEAFSWGQFGLGSRKRCLSAEEAAERQVKRACDQQGDSEERSPSTSIRQLPSAADDEVFVPGATPPPGCAVRSCLSASGLQALTHSPLLFQGKTPSSQRKEARDEDVDVFSPTAEDSPFSRAFSRRRPIGRSYSRKKLLS
>sp|E1BJH3|E1BJH3_BOVIN Centriolin OS=Bos taurus (Bovine) OX=9913 GN=CNTRL PE=4 SV=3
MKKGAQQKISKTKMPSSSHSPSPSSLTSNMRSRSLSPLNGSETLPFHSGRQWYEQVEIIGENTMLLDHHDQKEADSHAGVRYITEALVKKLTKQENLALVKSLNLSLSKDGGKKFKYIENLEKCTKLEILNLSHNLIGKIEKVDKLLKLRELNLSYNKICKIEGIENLHNLQKLNLAGNEIEHIPAWLGKKLKCLRVLNLKANKISSLQDVSKLKPLQDLTSLILAENPVVTLPHYLQFTIFHLRSLESLEGRPVTTQDRQEAFERFSLEEVERLERDLEKKMMETEELKSKQAQFLEEIKNQDKLNRSLKEEAMLQKQSCEELESNLTTKNELLRQKTMELTRACQKQYELEQELAFYKIDAKFEPLNYYPSEYVDVDKAPDESPYIGKSRYKRNMFATESYIVDNAQPVEIKRMEPEEGEQLRNERVSLKAHMPLDTELEDKESKISAGEDESL
>sp|E1B9U6|E1B9U6_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000026383 PE=4 SV=3
MTGPRALALLLLPVLLGWAGGHPVPGTKSFRKLLLISFDGFRWDYDQDVDTPNMDRLAQEGVKAKYLTPPFVTMTSPSHFTTISGRWIEDHGVIHNMMFNTETQWKYSFKTTQNKTEWWDNGVLPLWITAQRQGRKTASFHYPGGGAKYQGEAVQRSLVESHTHPNGNETEWRQNIDIVMNWFTKEDFDFVTLYYGEPDSVGHLYGPDTENRRAMIQQIDRTIGYLLEAIGRHSLTEHLNVIITSDHGMTTMKKKPNITEILLRNYISFKDLVQFDIVDYGGFGMLLPKPGQEEAVYQALKNAHPHLNVYKKEEFPERFHFAKHERVLPIVMYADPGYSISGRIILYFNKGDHGFDNVYMDMKTIFRAFGPDFKKNHLAEPFDSIHIYPLMCKLLGVTPEPHNGSLAVTQEMLADSLLLNHQGNPTRNIVYA
>sp|F1N0I3|F1N0I3_BOVIN Coagulation factor V OS=Bos taurus (Bovine) OX=9913 GN=F5 PE=3 SV=3
MFLACPGFWVLVVLGSSWAGWGNLGAEAAKLRQFYVAAQSIRWNYRPESTHLSSKPFETSFKKIVYREYEAYFQKEKPQSRTSGLLGPTLYAEVGDIMKVHFKNKAHKPLSIHAQGIKYSKFSEGASYSDHTLPMEKMDDAVAPGQEYTYEWIISEDSGPTHDDPPCLTHIYYSYVNLVEDFNSGLIGPLLICKKGTLTEDGTQKMFEKQHVLMFAVFDESKSWNQTSSLMYTVNGYVNGTMPDITVCAHDHISWHLIGMSSGPELFTIHFNGQVLEQNHHKISAITLVSATSTTANMTVSPEGRWTIASLIPRHFQAGMQAYIDIKNCAKKTRNPKKLTRDQRRHIKRWEYFIAAEEVIWDYAPIIPANMDKKYRSLHLDNFSNRIGKHYKKVVYKQYQDDSFTKRLEDPSSEGDGILGPIIRAQVRDTLKIVFKNMASRSYSIYPHGVTFSPYDNEVNSSSTSGSNTMIRAVRPGETYTYKWNILESDEPTENDAQCLTRPYYSNVDITRDLASGLIGLLLICKSRSLDRRGIQRAADIEQQAVFAVFDENKSWYIEDNIYKFCENPENSKSEASFYFTLPAINGYVPESIPILGFCFDDTVQWHFCSVGTQNDIFTIHFTGHSFIYGKRHEDTLTLFPMQGESVTVTMDNVGTWMLTTMNSNPRSKKLRLRFRDAKCIRNDDDDSYEIIYEPSGSTAMTTKKIHDSSEIEDENDADSDYQDELALILGLRSFRNSSLNQEKDELNLTALALEKDSEFIPPSANRSLGSNSSSPSHVSRLIANNFAESLKTLLHLEAPAAGSPLEHAGLDKNSALNPPMAEHSSPYSEDPREDHPLSDVTGISLLPFGTGFKNRKPAKHQRFQVGRGQAAKHKFSQTRFPAHKTRTRLSKDNSSSSRMGPWEDIPSDLLLLQQKDPYKILNGEWHLVSEKGSYEIIQDANENKTVNKLPNSPQNDSRTWGENIPFKNSHGKQSGHPTFLVTRRKPLQDRQDRRNRLKEGLPLIRTRRKKKEEKPAYHVPLSPRSFHPLRGEVNASFSDRRHNHSLLLHASNETSLSIDLNQTFPSMNLSLAASLPDHDQTSPNDTTSQTSSPPDLYPTVSPEEHYQIFPIQDSDPTHSTTAPSNRSPDPTHSTTAPSNRSPPTQPSQIPNYDLRNRAIPTDVSQIFPSLELEVWQTATSLDLSQPSISPDLGQMALSPDPGQESLSPDLGQTSLSPDLSQESLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLGQESLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLGQESLSPDLGQTALSPDLSLESLSPDLSQLDLKQTSPPLDLNQTSHTSESSQSLPLPEFGQTFPNADIGQMPSPPPDSTLNNTFKPEEFNPLVVVGLSRDDGDYIEIIPRQKEESSEEDYGEFEFVAYNDPYQTDLRTDINSSRNPDNIAAWYLRSNTGNRKYYYIAAEEISWDYSKFVQSDDVDYVPEDTVYKKVVFRKYLDSTFTKLDPQGEYEEHLGILGPVIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEGKTYEDDSPEWFKEDNAIQPNKTYTYVWHATTRSGPENPGSACRAWAYYSAVNPEKDIHSGLIGPLLICRKGTLDKETNMPVDMREFVLLFMVFDEKKSWYYDKKPTRSWRRASSEVKNSHEFHAINGMIYNLPGLRMYEQEWVRLHLLNLGGSRDIHVVHFHGQTLLENGTQQHQLGVWPLLPGSFKTLEMKASKPGWWLLDTEVGEIQRAGMQTPFLIVDRECKMPMGLSTSLIADSQIQASEFWGYWEPKLARLNNGGSYNAWIAEKLSTEFNPEPWIQVDMQKEVLLTGIQTQGAKHYLKPYYTTEFCVAYSLDRKNWRIFKGNSTRNVMYFGGNSDASTIKENQIDPPVVARYIRISPTGSYNKPALRLELQGCEVNGCSTPLGMESGKIENKQITASSFKKSWWGNYWEPFLARLNAQGRVNAWQAKANNNNQWLQIDLLKIKKITAIVTQGCKSLSSEMYVKSYTIHYSDQGTDWKPYREKSSMVDKIFEGNNNVRGHVKNFFNPPIISRFIRIIPKTWNQSIALRLELFGCDMY
>sp|G3MZ21|G3MZ21_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000047847 PE=4 SV=2
LDERTKHRHAQTHPEVLGIHVIHMQLVTVQLTQLSEGTFEVVQILNSFSEGGQHLLAMGLDLGVSHYGRGRGQVAKAVKESLGPGVDDQDLASSLFHIDFAPQASDSSLLLGSKIVLAWRIPGTGQPGGLPSMGLHRVGHD
>sp|G3X6Z1|G3X6Z1_BOVIN Patatin like phospholipase domain containing 7 OS=Bos taurus (Bovine) OX=9913 GN=PNPLA7 PE=4 SV=2
ISGPLHPWPPGALCVQPVFGVGGSWCLADGCSVYDLAQLLGIVIGVLLALALIGTTIFFVYRRVSQFRQLQPSPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGNTAAPRQRVRKRTKVLSLAKRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMVFVQLLEGEYIFRPGELDNSIYVVQDGRLEVRVQDSDGTEVTVKEVLAGDSVHSLLSILDVITGHAAPYKTVSARAAVPSTILRLPATAFQGVFERYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFNPESQAIPLMSVASVTAGKAKKPTCCNLEERPPRPQEPCADRGGSRATVCGPLPKRSHSVLLPSVYEEVAAELSQAQAGIQASSAPAGATAGAASDLRVVCDRARVLPHTEEHPGGAVASKPKKSVVVAETPSAVLPNSDGTLDESVTSKKTDSILRAATQDLLTLMKLDDPSLLDGRVALLHVPGGTVVLRQGDQDTSILFVVSGLLHVYQRKIDSEEDTFLFMARPGEMVGQLAVLTGEPLIFTIRANRDCSFLSISKAHFYDIMRRQPAVVLSVAHTVVRRVSSFVRQIDFALDWMEVEAGRAIYRQGDKSDCTYIVLSGRLRAVIQKDDGKKRLAGEYGRGDLVGVVETLTHQARATTVHAIRDSELAKLPEGALNSIKRQYPQVVTRLIRLLGEKILGSLQQGAAAGHQFGFHTVGSKWDSGNAASNLSTVAVMPVSEDVPLTAFTLELKHALSAIGPALLLTSDSIKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADSTLTPWTQRCIRQADCILIVGLGEQEPTVGELERMLETAAVRAQKQLVLLHRQDGPAPARTAEWLNMRGWCSGHLHLCCPRRVFSRRSLPKLVELYERVCQRPPDRHSDFSRLARVLTGNAIALVLGGGGARGCAQVGIIRALTEYGIPVDMVGGTSIGAFMGALYSEERSYSQIRIRAKQWAEDMMSMVKTMLDLTYPITSMFSGAGFNSSISSVFKDRQIEDLWIPYFAITTDISASAMRVHTDGSLWRYVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLTNYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKSSDYCEYLRPPIDSYGTLEFSKFDEICEVGYQHGRTVFDIWGRSGVLEKMLQDRQGTSKMKACDVLTCPNASFTDLAEIVSRIEPAKVAAGDDESDYQTEYEEVLLGGPKDAYVDFQSAPADRGSDSVSCLDTLCPLAEPRALRAPKQATAPSLLPSRVAPP
>sp|P63103|P63103_BOVIN 14-3-3 protein zeta/delta OS=Bos taurus (Bovine) OX=9913 GN=YWHAZ PE=1 SV=1
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
>sp|A0A452DHX8|A0A452DHX8_BOVIN Amine oxidase OS=Bos taurus (Bovine) OX=9913 GN=LOC100138645 PE=3 SV=1
MFIFIFLSLWTLLAMGREEGGAGSEEGVGKQCHPSLPPRCPSGSPSDQPWTHPDQSQLFADLSREELTAVMSFLTQQLGPDLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGKQPQPNVTELVVGPLPQPSYMRDVTVERHGGPLPYYRRPVLLREYLDIDQMIFNRELPQAAGVLHHCCSYKQGGQKLVTMNSAPRGVQSGDRATWFGLYYNISGAGFFLHPVGLELLVDHKALDPAQWTIQKVFFQGRYYESLAQLEEQFEAGQVNVVVIPDNGTGGSWSLKSQVPPGLAPPLQFHPQGPRFRVQGNRVSSSLWTFSFGLGGFSGPRIFDIRFQGERIAYEVSVQEALAIYGGNSPFALRGRYADANFGLGYFSTPLSRGVDCPYLATYVDWHFLLESQAPKTLQDAFCVFEENNGLPLRRHHSDFHSHYFGGVVETVLVFRSVSTMLNYDYVWDMVFHPNGAIEVKFHATGYISSVFLFGAARRYGNQVRENTLGTVHTHSAHYKVDLDVGGLENWVWAEDMAFVPMVVPWSPEHQIQRLQVTRKQLETEEQAAFPLGGPSPRYLYLASNQSNKWGHPRGYRIQTVSFAGGPLPQNSSMERAFSWARYQLAVTQRKEGEPSSTSIYNLNDPWSPTLDFSDFINNETIAGQDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDQEPSMDSADSIYFREGQDAGSCEVNPLACLSQAPACVPDLPAFSHGGFSHNQVVLGMRNVTGAPEPGSVGMGEDGH
>sp|A0A3Q1NGC5|A0A3Q1NGC5_BOVIN AMP_N domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=PEPD PE=3 SV=1
MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNTAVQAGSAVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVINVDTGTSTLFVPRLPPSHATWMGKIHSKEHFKEKYAVDDVQYTDEIASVLTSRSPSVLLTLRGVNTDSGSICREASFEGISKFNVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYEMESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDKTIQDGDMCVFDMGGEYYCFASDITCSFPANGKFTPDQKAIYEAVLRSCRAVMSAMKPGVWWPDMHRLADRIHLEELTRIGLLTGSVDAMVQVHLGAVFMPHGLGHLLGLDVHDVGGYPEGVDRIDEPGLQRLRTARHLEPRMVLTVEPGIYFIDHLLDEALADPARSCFFNREVLQRFRAFGGVRIEEDVVVTDTGMELLTCVPRTVEEMNTRLDLGSDPAEPSGGPNV
>sp|Q17QH1|Q17QH1_BOVIN APOF protein OS=Bos taurus (Bovine) OX=9913 GN=APOF PE=2 SV=2
MLPVELLLCCFLLHAADAISSGNQMDVLLHLPSPLESSLTSSYPLSCQTLLPKSLPGFTQMAPLPRFLVSLALMIALDKAGCQGDVQVLQLQLYRQGGVNATQTLIRHLQELEKSRSTGRRVSVDALASALQLWARENPGPQRARRSPSIKDCEQEQEQSVHKIAQMLPGVGTFYNLGTAIYYAVQNCSDVAKERGRDGVIDLGYDLLMAMAGGSRGSTGLIIGTALKPALKAGVQRLIQYYYEREANTPPPETSKEVLRSTSDMSEVEETTTMAPFVSKVVSSNPCWGWTLFNNCGLDPRYWNIEI
>sp|F1MS32|F1MS32_BOVIN Apolipoprotein D OS=Bos taurus (Bovine) OX=9913 GN=APOD PE=3 SV=3
MILRVETAFTSIKKVHLQPPSPRMVPVLLLLPALAGLFGAAEGQAFHLGKCPHPPVQENFDVNKYLGKWYEIEKIPVSFEKGSCIQANYSLKENGNVKVINKELRADGTVNQIEGEATPENITEPAKLAVKFFWFMPSAPYWVLATDYENYALVYSCTTIIWLFHMDHVWILGRNPYLPPETVTYLKDILTSNNIEVEKMTITDQVNCPESM
>sp|A0A140T881|A0A140T881_BOVIN Apolipoprotein E OS=Bos taurus (Bovine) OX=9913 GN=APOE PE=3 SV=2
MKGSLGWPIASQKMKVLWVAVVVALLAGCQADMEGELGPEEPLTTQQPRGKDSQPWEQALGRFWDYLRWVQTLSDQVQEELLNTQVIQELTALMEETMKEVKAYKEELEGQLGPMAQETQARVSKELQAAQARLGSDMEDLRNRLAQYRSEVQAMLGQSTEELRARMASHLRKLRKRLLRDADDLKKRLAVYQAGASEGAERSLSAIRERFGPLVEQGQSRAATLSTLAGQPLLERAEAWRQKLHGRLEEVGVRAQDRLDKIRQQLEEVHAKVEEQGNQMRLQAEAFQARLRSWFEPLVEDMQRQWAGLVEKVQLALRPSPTSPPSENH
>sp|A0A3Q1MB70|A0A3Q1MB70_BOVIN Apolipoprotein M OS=Bos taurus (Bovine) OX=9913 GN=APOM PE=4 SV=1
MAINLKTCRTGEWGLLKRSKEEKSFNDSLSWIQSLAGKRQPTPSFLSIVILTDEEVGFCSETHLLLLPSLSLQFPEPHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAVGSAPMQLQLRATIRTKNGLCVPRKWIYHLSDGSTDLRTEGRPDMKTKLFSSACPGGIMLKETGQGYQRFLLYNRSPHPPEKCVEEFQSLTSCLDFKAFLLTPRNQDACELSSN
>sp|Q2KIH2|Q2KIH2_BOVIN ApoN protein OS=Bos taurus (Bovine) OX=9913 GN=APON PE=2 SV=1
MMRAVLLLCCVLMSPVAAFPRNAQEGVLTFQPSISEIGHPLNLLSNQILLPDPKTCQDLLHVAPSLAPLPEYLSNLALEVVLEEIGCTTEAHILQLQLVKIGGKDTTETLIRESKKHNEGEGTGQVKVILKDLGRSPGELRRAQRSVTLPEACRQEDRWVLYETAKMIAEFAEKLPNTELVKEFKAAATDVTQKCTDESWEYLQAVSNQLVKSPEMKDFTMPMQDQLYFIKRSMTILMHIVVEFIKTQVQNIFG
>sp|A0A140T843|A0A140T843_BOVIN Beta-2-glycoprotein 1 OS=Bos taurus (Bovine) OX=9913 GN=APOH PE=4 SV=1
MLPPALVLLLGFLCHVAIAGRTCPKPDELPFSTVVPLKRTYEPGEQIVFSCQPGYVSRGGIRRFTCPLTGLWPINTLKCMPRVCPFAGILENGTVRYTTFEYPNTISFSCHTGFYLKGASSAKCTEEGKWSPDLPVCAPITCPPPPIPKFASLSVYKPLAGNNSFYGSKAVFKCLPHHAMFGNDTVTCTEHGNWTQLPECREVRCPFPSRPDNGFVNHPANPVLYYKDTATFGCHETYSLDGPEEVECSKFGNWSAQPSCKASCKLSIKRATVIYEGERVAIQNKFKNGMLHGQKVSFFCKNKEKKCSYTEDAQCIDGTIEIPKCFKEHSSLAFWKTDASDVKPC
>sp|A0A3Q1MU93|A0A3Q1MU93_BOVIN Beta-2-microglobulin OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000048782 PE=3 SV=1
MARFVALVLLGLLSLSGLDAIQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWGKKFF
>sp|A0A3Q1M0F4|A0A3Q1M0F4_BOVIN BPTI/Kunitz inhibitor domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=LOC404103 PE=4 SV=1
MKLSRLCLSIALLVLLGTLAASTPGCDTSNQAKAQRPDFCLEPPYTGPCKAKMIRYFYNAKAGFCETFVYGGCKAKSNNFRSAEDCMRTCGGAIGPRGKTGGRVEGEGKGEGKRWRSEGHTPFQKSDFFPRCFPREVAAVSVD
>sp|A0A3Q1M564|A0A3Q1M564_BOVIN C1q domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ADIPOQ PE=4 SV=1
MMTAALLGIPSPNWVAPGSLEWQAKGAARGTCLPIGLWLSLCWPMGRDGGGAGAACPHEYRAAEAAPSPPTSTLTEVCGSDSTPEGLRMLLQGALLLLLALPSHGEDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
>sp|A0A3B0IZF8|A0A3B0IZF8_BOVIN C1q domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=C1QC PE=4 SV=1
MGSGAWPLLVLNLLLLLLARPLRGQTETYCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAAPGTRGPKGQKGDPGTPGYPGKNGPMGTPGIPGAPGTMGPPGEPGVEGRYKQKHQSVFSVTRQTVQFPEANSLVKFNRVITNPQGHYDKDSGKFTCKVPGLYYFVFHTSHTSNLCVLLYRSGFKVATFCDHMTSAKQVSSGGVLLRLQEGQQVWLAVNDYNGMVGMEGSDSVFSGFLLFPD
>sp|P13135|P13135_BOVIN Calpain small subunit 1 OS=Bos taurus (Bovine) OX=9913 GN=CAPNS1 PE=2 SV=1
MFLVNSFLKGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGTAMRILGGVISAISEAAAQYNPEPVPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAVYKQFDVDRSGTIGSSELPGAFEAAGFRLNEHLYNMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
>sp|P35445|P35445_BOVIN Cartilage oligomeric matrix protein OS=Bos taurus (Bovine) OX=9913 GN=COMP PE=1 SV=2
MVLAAARVLLLTLAALGASGQGQMPLGGDLGPQMLRELQETNAALQDVRDLLRQQVKEITFLKNTVMECDACGMQPARTPKLTVRPLSQCSPGFCFPGVACTETANGARCGPCPEGFTGNGSHCADVNECTAHPCFPRVRCINTSPGFRCEACPPGFSGPTHEGVGLAFAKANKQVCTDINECETGQHNCVPNSVCVNTVGSFQCGPCQPGFVGDQASGCRRRPQRFCPDGTPSPCHEKADCVLERDGSRSCVCAVGWAGNGLICGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQEDVDQDGIGDACDPDADGDGVLNEKDNCPLVRNPDQRNTDGDKWGDACDNCRSQKNDDQKDTDKDGRGDACDDDIDGDRIRNPVDNCPKVPNSDQKDTDGDGVGDACDNCPQKSNADQRDVDHDFVGDACDSDQDQDGDGHQDSKDNCPTVPNSAQQDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDMDRDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTASQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVILDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYEAQRLLQA
>sp|A6QNW7|A6QNW7_BOVIN CD5 molecule like OS=Bos taurus (Bovine) OX=9913 GN=CD5L PE=2 SV=1
MALFFFLIFAFSTGPGLLESPPKVRLVRGPHRCEGRVEVERNGEWGTVCDDGWNLKDVEVVCRELGCGAAKGTPSGNLYKPLADEKQKIFIQDVNCNGTEDELIECDRVEDVFDCSHSEDAGAICEKSPPKVRLVRGPHRCEGRVEVERNGEWGTVCDNGWNMKDVEVVCRELGCGAAKGTPSRNLYKPLADEKQKIFIQDVNCNGTEDELIECDRVEDVFDCSHSEDAGAICERTVRLVDGPGRCKGRLEVKHQKQWGTVCKAGWNLSAAKVVCRQLGCGKATLIKRCCNKDTQGQGLIWLSNVSCSGQEEDLQHCLSGLEGYNNCTHDEDTWVECEDPFKLRLVNGDTSCSGRLEVLHKGIWGSVCDDGWAKKEEQVVCQQLGCGKPIFVPAKARKKFVPGNGRIWLDDVHCKGEEQSLEQCQHRSWGYHDCNHKEDVVVFCLEGQPDI
>sp|A0A140T891|A0A140T891_BOVIN CN hydrolase domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=VNN1 PE=4 SV=1
MIMSQLLNYVAVLFFCVSRASSLDTFIAAVYEHAVILPNATLVPVSPEEALAVMNRNLDLLEGAVTSASKQGAHIIVTPEDGIYGFNFTRESIYPYLEDIPDPQVNWIPCNNPDRFGHTPVQQRLSCLAKDNSIYIVANIGDKKSCNASDPQCPPDGRYQYNTDVVFDTKGKLVARYHKQNLFLNEDQFNAPKEPEVVTFNTTFGKFGIFTCFDILFHDPAVTLVRDSRVDTILFPTAWMNVLPHLSAIEFHSAWAMGMRVNFLASNLHYPLKKMTGSGIYAPDSPRAFHYDMKTEEGKLLLAQLDSHPHPTPVVNWTSYASGVEAHSVGNQEFTGIIFFDEFTFLELKEIGGNYTVCQRDLCCHLSYKMSEKRSDEVYALGAFDGLHTVEGSYYLQICTLLKCKTTDLHTCGDSVETASTRFEMFSLSGTFGTQYVFPEVLLSEIQLAPGEFQVSNDGRLFSLKPTSGPVLTVTLFGRLYEKDSAPNTLSDLTTQALRLNPKTDAWKSK
>sp|P00741|P00741_BOVIN Coagulation factor IX OS=Bos taurus (Bovine) OX=9913 GN=F9 PE=1 SV=2
MWCLNMIMAESPGLVTICLLGYLLSAECTVFLDRENATKILHRPKRYNSGKLEEFVRGNLERECKEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGMCKDDINSYECWCQAGFEGTNCELDATCSIKNGRCKQFCKRDTDNKVVCSCTDGYRLAEDQKSCEPAVPFPCGRVSVSHISKKLTRAETIFSNTNYENSSEAEIIWDNVTQSNQSFDEFSRVVGGEDAERGQFPWQVLLHGEIAAFCGGSIVNEKWVVTAAHCIKPGVKITVVAGEHNTEKPEPTEQKRNVIRAIPYHSYNASINKYSHDIALLELDEPLELNSYVTPICIADRDYTNIFLKFGYGYVSGWGKVFNRGRSASILQYLKVPLVDRATCLRSTKFSIYSHMFCAGYHEGGKDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
>sp|A0A452DIP8|A0A452DIP8_BOVIN Coagulation factor X OS=Bos taurus (Bovine) OX=9913 GN=F10 PE=3 SV=1
MRHDFYHGRKDENRAGCGRLGTTQRCSCSQNKVLCAHARPLDTAQDESELSRDLPGAAGAGRPGPQSRPPPPQAWAPTGGCDKQAGRQPPSSLGERTLPWRPVAAGTHGCPRKGPTMAGLLHLVLLSTALGGLLRPAGSVFLPRDQAHRVLQRARRANSFLEEVKQGNLERECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTREICSLDNGGCDQFCREERSEVRCSCAHGYVLGDDSKSCVSTERFPCGKFTQGRSRRWAIHTSEDALDASELEHYDPADLSPTESSLDLLGLNRTEPSAGEDGSQVVRIVGGRDCAEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEQEEGNEMAHEVEMTVKHSRFVKETYDFDIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIVSGFGRTHEKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPNMFCAGYDTQPEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIDKIMKARAGAAGSRGHSEAPATWTVPPPLPL
>sp|A0A3Q1LT55|A0A3Q1LT55_BOVIN Coagulation factor XI OS=Bos taurus (Bovine) OX=9913 GN=F11 PE=3 SV=1
MTLLYQMVHFALFASVAGECVTTLFQDACFKGGDITVAFAPNAKHCQIICTHHPRCLLFTFMTESSSEDPTKWYTCILKDSVTETLPMVNMTGAISGYSSKQCLHHISACSKDMYVDLNMKGMNYNSSLAQSARECQQRCTDDTHCHFFTFATRHFPSIKDRNTCLLKNTQTGTPTSITKLHEVVSGFSLKSCGLSNLACIRDIFPRTAFVDITIDTVMAPDPFVCRSICTHHPSCLFFTFLSEEWPTASERNLCLLKTSSSGLPSARFRKNRAFSGFSLQHCQHSVPVFCHSSFYRNTDFLGEELDIVDADSHEACQKTCTNSIRCQFFTYSPSQESCNGGKGKCYLKLSANGSPTKILHGTGSISGYTLRLCKMDNVTADILIFQVKKELRVCTTKIKTRIVGGTQSVHGEWPWQITLHVTSPTQRHLCGGAIIGNQWILTAAHCFNEVKSPNVLRVYSGILNQSEIKEDTSFFGVQEIIIHDQYEKAESGYDIALLKLETAMNYTDSQWPICLPSKGDRNVMYTECWVTGWGYRKLRDKIQNTLQKAKVPLMTNEECQAGYREHRITSKMVCAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCGQRERPGVYSNVVEYLDWILEKTQGP
>sp|P98140|P98140_BOVIN Coagulation factor XII OS=Bos taurus (Bovine) OX=9913 GN=F12 PE=1 SV=2
MRALLLLGALLVSLESTVSTPPWKGPKKHKLTDSEHTVVLTVTGEPCHFPFQYHRQLHHKCIHRGRPGPRPWCATTPNFEKDQRWAYCLEPKKVKDHCSKHNPCQKGGTCVNMPDGPRCICADHFTGKHCQKEKCFEPQFFRFFHENEIWHRLEPAGVVKCQCKGPNAQCKPLASQVCRTNPCLNGGSCLQAEGHRLCRCAPSFAGRLCDVDLKASCYDDRDRGLSYRGMAGTTLSGAPCQSWASEATYWNVTAEQVLNWGLGDHAFCRASTPPRGYRNPDNDTRPLCFIWKGDRLSWNYCRLAPCQAAAGHEHFPLPSPSALQKPESTTQTPLPSLTSGWCSPTPLASGGPGGCGQRLRKWLSSLNRVVGGLVALPGAHPYIAALYWDQHFCAGSLIAPCWVLTAAHCLQNRPAPKELTVVLGQDRHNQSCEQCQTLAVRDYRLHEAFSPITYQHDLALVRLQESADGCCAHPSPFVQPVCLPSTAARPAESEAAVCEVAGWGHQFEGGEYSSFLQEAQVPLIDPQRCSAPDVHGAAFTQGMLCAGFLEGGTDACQGDSGGPLVCEDETPERQLILRGIVSWGSGCGNRLKPGVYTDVANYLAWIREHTAS
>sp|Q2TBQ1|Q2TBQ1_BOVIN Coagulation factor XIII B chain OS=Bos taurus (Bovine) OX=9913 GN=F13B PE=2 SV=1
MRSKSLALIIILIISGELHAEEKPCGFPSVENGRIAQYYYIFESYYFPMSINQNLAFSCLVGYTTATGKREARTTCTAAGWSPEPRCFKKCPKPDLKNGYIFDSKLSYKIQENMRYRCTSGYKTMAGQDEEVVQCLADGWSPQPTCSKEHETCLAPELHHGNYFTTQKTFKVKERVRYECASGYHTASGKSTEEAECHPYGWALTPQCTKLKCSSLRVIENGYFHPVKQTYEEGDVVQFFCHKNYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPLPLPLNSNLQTYSTTYRHGETVRIECALNFAMQGAEEIRCENGKWTEPPRCVEDKQRMTCEAPPSVEHGTTTPSSEVYHSGDKVAYVCERGYHLRGPGEITCNRGRWTLPPECVENTENCNPPPDVINGAIIGELLASYPTGSSVEYRCNEYYLLRGAKISHCEQGRWSSPPVCLEPCTVNVGDMRRNHVELKWNYEGKILHGDLIDFVCKQGYELSPSTPPSELSVQCDRGEVKYPSCVRKESKRMCASPPAIKNGVIKSSTLSTYENGSSVEYICFKHHFLQGARESYCLEGVWTTPPSCLEPCTLSFDTMENNNLLLKWNFDNRPYIFHGEYVEFLCKGDTYIAGFPDPVSESRVQCDRGQLNYPRCVQRERMLSYQEPLRT
>sp|Q08E14|Q08E14_BOVIN Collagen alpha-1(III) chain OS=Bos taurus (Bovine) OX=9913 GN=COL3A1 PE=2 SV=1
MMSFVQKGTWLLFALLHPTVILAQQEAVDGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGPPGSPGSPGSPGPPGICESCPTGGQNYSPQYEAYDVKSGVAGGGIAGYPGPAGPPGPPGPPGTSGHPGAPGAPGYQGPPGEPGQAGPAGPPGPPGAIGPSGPAGKDGESGRPGRPGERGFPGPPGMKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGVPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSSGAPGQRGEPGPQGHAGAPGPPGPPGSNGSPGGKGEMGPAGIPGAPGLIGARGPPGPPGTNGVPGQRGAAGEPGKNGAKGDPGPRGERGEAGSPGIAGPKGEDGKDGSPGEPGANGLPGAAGERGVPGFRGPAGANGLPGEKGPPGDRGGPGPAGPRGVAGEPGRDGLPGGPGLRGIPGSPGGPGSDGKPGPPGSQGETGRPGPPGSPGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGPQGPAGKNGETGPQGPPGPTGPSGDKGDTGPPGPQGLQGLPGTSGPPGENGKPGEPGPKGEAGAPGIPGGKGDSGAPGERGPPGAGGPPGPRGGAGPPGPEGGKGAAGPPGPPGSAGTPGLQGMPGERGGPGGPGPKGDKGEPGSSGVDGAPGKDGPRGPTGPIGPPGPAGQPGDKGESGAPGVPGIAGPRGGPGERGEQGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGAAGPAGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGGRGPPGPPGSNGNPGPPGSSGAPGKDGPPGPPGSNGAPGSPGISGPKGDSGPPGERGAPGPQGPPGAPGPLGIAGLTGARGLAGPPGMPGARGSPGPQGIKGENGKPGPSGQNGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGAPGAKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGETGPAGPSGAPGPAGSRGPPGPQGPRGDKGETGERGAMGIKGHRGFPGNPGAPGSPGPAGHQGAVGSPGPAGPRGPVGPSGPPGKDGASGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGAGGVAAIAGVGAEKAGGFAPYYGDEPIDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELQSGEYWVDPNQGCKLDAIKVYCNMETGETCISASPLTIPQKNWWTDSGAEKKHVWFGESMEGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDHASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWGKTVFQYQTRKAVRLPIVDIAPYDIGGPDQEFGADIGPVCFL
>sp|F1N401|F1N401_BOVIN Collagen alpha-1(XII) chain OS=Bos taurus (Bovine) OX=9913 GN=COL12A1 PE=4 SV=3
MRIRLPPALAALGAALLLSSIEAEVEPPSDLNFKIIDENTVHMSWAIPPDPIVGFKITVDPTTDGPTKEFTLSASTTETLLTELIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPTKPGEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVGVVQYSSDTRTEFNLNQYYQQEELLAAIKKIPYKGGNTMTGEAIDYLIKNTFTESAGARVGFPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVANFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVVEPPSNLIATEVSSKYVKLSWSPSPSAVTGYKVLLIPMTTGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGLTSSEPVSIMEKTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQISLVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSNVPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVEDFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDINFSEVTSNSLKTSWSPAGENVFSYHITYKEATGDDQVTLVEPASSTSVVLSNLKPETLYLVNVTAEYEDGFSIPLAGEETTAEVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRITYRPVAGGESKEVTTPANQRRRTLENLTPDTKYEVSVIPEYVSGPGSPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWTRAPGKVKQYLITYTPVAGGDTQEVTVKGDTASTVLRGLNEGTQYALSVTALYASGAGDALFGEGTTLEERGSPGDLITKDITDTSIGAYWTSAPGMVRGYRVSWQSLYDDIETGEKSLPADVIHTVIENLQPETKYRVSIFATYSSGEGEPLSGEAMTELSEDSKTLKVDEETENTMRVTWKPAPGKVVNYRVMYRPRGGGRQMVAKVSPTVTSTVLKRLQPQTTYDITVLPVYKTGEGKLRQGSGTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDNTVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGMECLTRAEADIVLLVDGSWSIGRANFRTVRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHKDKKSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQAGMRPRARKIGVLITDGKSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDIHAYNVADFDSLSRIVDDLTNNLCNSVKGPGDLEAPSNLVLSERTHRSMRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLERSTVLKDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDIGSTTMHVQWQPVGGATGYTVTYEPINATVPTKPKEMRLEPTVNDVQLSDLFPNTEYAVTVQAVLHDLTSEPVTAREVTLPLPSPRDLKLRDVTHSTMNVAWEPAPGKVRKYIVRYKTPEEEAKEVEVDRSRASTPLKDLFSQTLYTVSVSAVYEEGESPPVTAQETTHTVPAPTNLQITEVTPESFRGTWDHGASDVSLYRITWAPSGSADKMETILNGDENTLVFQNLNPNTLYEVSVTAIYPDESESDDLIGSERTLRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQTTTIGGRQNSVLLQKLKPDTPYTITVSSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTSSLNVRWDHAEGSPRQYKLFYAPTAGGPEELVPIPGNTNYAILRNLQPDTQYTVTVVPVYSEGDGGRTSDTGRTLVRGLARNVQVYNPTPNSLDVRWDSAPGPVQQYRIVYSPQDGTRPSESIVVPGNTYTVHLEQLIPDTPYSVNIVALYSDAEGNPSPAQGRTLPRSGPRNLRVFGETTNSLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIPVYEDGDGTHLTGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEPMEVFVGEVTSYTLHNLNPSTTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQVGWDTFCVRWLAHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTDLSPETDYGVTVFVQTPNLEGPGVSVKERTTLKPTEAPTEPPTPPPPPTIPPAREVCKGAKADIVFLTDASWSIGDDNFNKVVKFIFHTVGGFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRGGNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALVIQQSGFSVFVVGVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEKNFASVQGVSLESGSFPSYSSYRLQKNAFVNQPTVELHPNGLPPSYTIILLFRLLPETPSDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTDEVKALFYGSFHKVHIVVTSKSVKIYIDCYEIVEKDIKEAGNITTDGYEILGKLLKGERKSATFQIQNFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGPGAKGPRGERGVSGAVGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPGLPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPGDHGRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMNRFNQMLNQIPNDYHSSRNQPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPQGERGLPGEKGERGIGSPGPRGLPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQGYPGSG
>sp|P02465|P02465_BOVIN Collagen alpha-2(I) chain OS=Bos taurus (Bovine) OX=9913 GN=COL1A2 PE=1 SV=2
MLSFVDTRTLLLLAVTSCLATCQSLQEATARKGPSGDRGPRGERGPPGPPGRDGDDGIPGPPGPPGPPGPPGLGGNFAAQFDAKGGGPGPMGLMGPRGPPGASGAPGPQGFQGPPGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLPGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGAVGQPGPPGPSGEEGKRGSTGEIGPAGPPGPPGLRGNPGSRGLPGADGRAGVMGPAGSRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPGPDGNNGAQGPPGLQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEAGKPGERGIPGEFGLPGPAGARGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAPGTAGPSGPSGLPGERGAAGIPGGKGEKGETGLRGDIGSPGRDGARGAPGAIGAPGPAGANGDRGEAGPAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRSGETGASGPPGFVGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPVGAAGAPGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGDQGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVGPAGIRGSQGSQGPAGPPGPPGPPGPPGPSGGGYEFGFDGDFYRADQPRSPTSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCFK
>sp|E1BB91|E1BB91_BOVIN Collagen type VI alpha 3 chain OS=Bos taurus (Bovine) OX=9913 GN=COL6A3 PE=1 SV=2
MRKHRHLPLVAILCLFFSGFSFTRGQQQPDVKNGAAADIIFLVDSSWSIGKEHFQLVREFLYDVIESLAVGDNDFRFALVQFNGNPHTEFLFNTYRSKQEVLSHVSNMSYIGGSNQTGKGLAYVMQNHLTEAAGSRASDGVPQVIVVLTHGHSEDGLALPSAELKSADVNVFAIGVEDADEAALKEIASEPLNMHVFNLENYTSLHDIVGNLVACVRSSMAPERAGGTEIPKDITAQDSADIIFLIDGSNNTGSVNFAVILDFLVNLLERLSIGTQQIRVGVVQYSDEPRTMFSLNSYSTKAQVLDAVKALGFIGGELANVGLALDFVVENHFTRAGGSRAEEGVPQVLVLISAGPSSDEIRDGVVALKQASVFSFGLGAQAASKAELQHIATNDNLVFTVPEFRSLGDVQEQLLPYIVGVAQRHIVLQPPTIVTQVIEVNKRDIVFLVDGSSKLGLTNFNAIRDFIAKVIQRLEIRQDLIQVAVAQYADTVRPEFYFNTYPSKREVINAVRKMKALDGSALYTGSALDFVRNNLFTEAAGYRAAEGVPKLLVLVTGGKSLDAVSQPAQELKRSGILAFAVGNKVADQAELEEIAFDSSLVFTATEFRPAPLQGVLPGLLGPLRTLTGTTEVRVNKRDIIFLLDGSSNVGETNFPYVRDFVMNLVNSLDVGSDHIRVGLVQFSDTPVTEFSLNTYPTKSELLAHLRQMQLQGGSVLNTGAALSYVHANHFTEAGGSRIQDHVPQLLLLLTAGQSEDSYLQAANALARAGILTFCVGTSQADRAELEEIAFNPGLVYLMDDFSSLPALPQQLIQPLTTYVSGGVEEVPLAQPESKRDILFLFDGSANLMGQFTAARDFLYKVIDELDVKPEGTRVAVAQFSDDVKVESRFDQHQNKPEILNLVKRMKLKTGKALNLGYALDYAQRYIFVKSAGSRIEDGVLQFLVLLVAGKSSDRVDTPALNLKQSGVVPFILQAKNADPAELELIVPSPAFILVAESLPKIGDLQPQIVNLLKSVQNGAPAPVSVEKDVVFLIDGSEGVRSGFPLLKEFVQRVVESLDVGPDRVRVAVVQYSDRTRPEFYLNSYMDQQSVVGAIRGLTLLGGPAPNTGAALEFVLRNILVGSAGSRIAEGVPQLLIVLTADRSGDDVRGPSVVLRRGGAVPIGIGIGNADITEMQTLSFVPDFAVVIPTFRQLGTIQQVISERVTQLSREELSRLQASVTPLTTPVVSSKRDVVFLIDGSQSAGPEFQYIRTLIERLVDYLDVGFDTTRVAVIQFSDDPRVEFLLNVHSSKDEVQNAVRRLRPKGGRQVNVGGALEYVARNIFKRPLGSRIEEGVPQFLVLISSGKSDDEVEDSAIELKQFGVAPLTIARNVDQEELVKISLSPEYVFSVNTFRELPSLEQKLLTPLTTLTAGQIQQLLASTRYPPPAVESDAADIVFLIDSSDGVKPDGIAHIRDFVIRIVRRLNVGPNKVRIGVLQFSNDVFPEFQLKTYKSQASVLDAIRRLRFKGGSPLNTGKALEFVARNYFVKSAGSRIEDGVPQHLVLFLGGKSQDDISRYSQVIKSAGIASLGVGDRNIDRTELQTITSDPRLVFTVREFRDLPSIEERMVNSFGSSGVTPAPPGVDTPSPSRPEKKKADIVFLLDGSINFRRDSFQEVLRFVSEIVDTVYEGGDSIQVGLVQYNSDPTDEFFLKDFPTKQQIIDAINKVVYKGGRHANTKVGLEHLRRNHFVPEAGSRLDQRVPQIAFVITGGKSVEDAQEASMALTQRGVKVFAVGVRNIDSEEVGKIASNSATAFRVGNVQELSELSEQVLETLHDAMHETLCPGVTDVSKACNLDVILGFDGSGDQNVFVAQKGLEPKVDTILRRISQMQKISCSGSQLPTVRVSVVALTPSGPVEAFDFAEYQPELFEKFQNMRAQHPYVLTADTLKLYQNKFRQASMDNVKVVIHFTDGVDGDLADLQRASEELRQEGVRALILVGLERVANLEQLMQLEFGRGFTYNRPLRLNLLDLDYELAEQLDNIAEKACCGIPCKCSGQRGDRGPIGSIGPKGIPGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGELGEIGLDGLDGEDGDKGLPGTSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGNSGQDSQQRGAKGETGDIGPVVQCSPFLPVQSNLPLCGSCGGRGGSPPRSTYVGILLLQGPPGPTGPPGLIGEQGIPGPRVSLAWTLSKSGEPGDPGPKGSIGNRGPRGETGDDGRDGVGSEGRIGKKVFICRGGNPGEPGTDGPPGPKGIRGRRGNSGPPGIAGQKGDPGYPGPSGYKGSRGDSMDQCALVQSIKDKCRPLECPVFPTELAFALDTSEGVTQDRFSQMREVVLKILDDLTIAESNCPRGARVAVVTYNNEVTTEIRFADSKKKSVLLDKIKNLQVSLTSKQQSLETAMSFVARNTFKRVRSGFLMRKVAVFFSNKPTRATPQLREAVLKLSDAGITPLFLTSQEDRQLINALQINNTAVGHALVLPAGGDLTDFLKNVLTCHVCLDICNIDPSCGFGSWRPSFRDRRAAGSDVDIDMAFILDSSESTTPFQFNEMRKYIEYLVRQLDVSPDPKASQHFARVAVVQHAPYEAVDNASVPPVKVEFSLTDYGSKEKLLAFLGSRMTQLQGTRALGRAIDYTIENIFESAPNPRDLKIVVLMLTGEVQKQQLEEAQRAILQAKCKGYFFVILGIGRKVNVKELYSSASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSKDAFYLSPDIRKQCDWFQADQPAKNLVQFGYKQINVPNNVTSSPTSKLVTTTKPVITTTKPITVVNLPASKPAATRPVDERPAAGRSVATKMDSARPVATKTEATKPAEAAKPTATKPVAARPPTAARSMATRSEAPRPQAVKLAASRPGAAKPVVKAPREIHVSEVTENSAKLHWERPEPPSPYLYNLTVTSAHDQAVVLKQNLTVTDRVIGGLLPGQTYHVTVTCSLRSQVRAIYQGSFSTKKIQPPPPQTERSASSATINLVVSADRLAGSKADICKLPKDGGTCREFVLKWYYDSVTENCARFWYGGCGGNENRFNSQDECEKVCPPVPIKQPGVIAAMGT
>sp|Q5E9E3|Q5E9E3_BOVIN Complement C1q subcomponent subunit A OS=Bos taurus (Bovine) OX=9913 GN=C1QA PE=2 SV=1
MEAPRGWLVISVLAISLASSVTEDVCRAPDGTHGSAGIPGRPGRPGLKGERGEPGAPAIQTGIRGLKGDQGDPGPPGNPGRMGYPGPSGPMGPAGLPGLKGTKGSPGNIKDQPRPAFSAVGPNSVSRDNVVVFGKVITNQENVYQNNTGRFRCSVPGYYYFTFQVVSNWDICLSIRSSRRDQIQPLGFCDFNSKGFFQVVSGGTVLHLQQGDQVWIEKDPSKGRIYHGSEADSIFSGFLIFPSA
>sp|Q2KIV9|Q2KIV9_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus (Bovine) OX=9913 GN=C1QB PE=1 SV=1
MKTPRGSVLVLLLLNLLRVSWAQSNCIRPSIPGIPGIPGKPGSDGKPGTPGTKGEKGLPGLVSHLNENGEKGDPGFPGMPGKVGPKGPIGPKGVPGPPGVRGPKGESGDYKATQKIAFSASRTINHHQRQGQPIRFDHVITNANENYQARSSKFTCKVPGLYFFTYHASSRGQLCVDLMRGRAEPQKVVTFCDYVQNTFQVTTGSIVLKLEKDETVFLQATEKNALVGIEGANSIFSGFMLFPDTEA
>sp|A0A3Q1MGP1|A0A3Q1MGP1_BOVIN Complement C1r OS=Bos taurus (Bovine) OX=9913 GN=C1R PE=3 SV=1
MDREENAQRWLLYLLLPVLFYRVGGATPTPQKLYGEVMSPLFPKPYPNNFERTTVITVPTGYKVKLVFWQFDLEPSEGCLYDYVKISADKKTMGRFCGQLGSPLSNPPGRKEFMSQGNKMLLTFHSDFSNEENGTIMFYKGFLAYYQAVDVDECALQLNSVEEDPPAGCQHLCHNYVGGYFCSCRPGYELQPDGRSCQAECSSELFTEPSGYISSLEYPRPYPPDLRCNYSIRVERGHTLHLQFLEPFEIDDHQQIHCPYDQLQVYVSGRNIGEFCGKQRPERIDAQSNSVDLLFFTDESGDSRGWKLYYTSEVIKCPQPKTLDSFTIIQDLQPQYQYRDYFIATCKKGYELVEGNKALLSFTAVCQDDGTWHRAMPRCRIKDCGQPRSLLNGAFNYTTREGVNTYEARIQYYCHEPFYKMHTKGGTSESERGLYTCTAQGIWKNELVGEKMPRCLPVCGKPLHPVEQRQRIIGGLKAKLGNFPWQAYTNIHGPGGGALLGDRWILTAAHTINPKDHEAQGSPNIDVFLGHINVEDITKLSNHPVRRVIIHPDYRQEESHNFEGDIALLELENSVTLGPNLLPICLPDNETLYDPGLMGYVSGFGIMEERISHNLRFVRLPVAKREICERWLRQKNRNDVFSENMFCAGNPATRQDSCQGDSGGVFAVSDKRNDRWVATGIVSWGIGCGEGYGFYTNVLKYVDWIKKVMEVED
>sp|Q3SYW2|Q3SYW2_BOVIN Complement C2 OS=Bos taurus (Bovine) OX=9913 GN=C2 PE=2 SV=1
MDPLMAVLCLLPLYPGLATAALSCPKNVNISGGSFTLSNGWNPGSILTYSCPLGHYPYPVVTRLCKSNGQWQIPRSTRSTKAICKPVRCPAPVSFENGVYIPRLGSHPVGGNLSFECEDGFTLRGSAVRQCRPNGMWDGETAVCDNGASHCPNPGISVGAVRTGSRFGLGDKVRYRCSSNLVLTGSAERECQDDGVWSGTEAICRQPYSYDFPEDVAPALGTSFSHLLATTNPIQQKKKQNLGRKIQIQRSGHLNLYLLLDASQSVSKDDFEIFKDSASRMVDRIFSFEIKVSVAIITFASKPKIIMSVLEDRSRDVTEVENSLRNINYKDHENGTGTNIYEALHAVYIMMNNQMNRPHMNPGAWQEIRHAIILLTDGKSNMGGSPKVAVDNIKEVLNINQKRKDYLDIYAIGVGSLHVDWKELNNLGSKKDGERHAFILKDVQALSQVFEHMLDVSQLTDPICGVGNMSANASAQERTPWHVTIKPKSQETCRGALISDQWVLTAAHCFRNAEDRTLWRVSVGDPNFQGSKEFQIEEAVISPGFNVFSKKSQGIPEFYGDDIALLKLTQKVKMSTHARPICLPCTVGANLALRKLPGSTCRDHEKELLNQVSIPAHFVALNGDKLNINLKTGSEWTNCVKVVLKDKTTFPNLTDVREVVTDQFLCSGTQGDDSPCKGESGGAVFLERRLRFFQVGLVSWGLYNPCGGSSKNSRKPAPHGKVPRDFHINLFRLQPWLRQHLEGILNFVPL
>sp|A0A3Q1LM32|A0A3Q1LM32_BOVIN Complement component C6 OS=Bos taurus (Bovine) OX=9913 GN=C6 PE=4 SV=1
MARHSVLYFILLSALIDKSQACFCDHYPWSQWSSCSKTCNSGTQTRQRRIVTDKYYFENFCGQLCTKQESRECNWQTCPINCRLGDYGPWSDCDPCVQKRFKVRSILRPSQFGGQPCTEPLMTFQPCIPSKLCKIEEIDCKNKFRCDSGRCIASKLECNGENDCGDNSDERNCGRKKTVCSRSHNPIPGVQLMGMGFHFLAGEPRGEVLDNSFTGGVCRTVKSSRASNPYRVPANLENVNFEVQTKEDDLEADFYDDLIPLEDNKDQEALGSGLATSSFRVPIFYSSKRSQSSSHSSAFKQAIQASQKKASSFIRIHKVIKVLNFTMKTKDLQLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQFSKEELKNSGLTKEEAKNCIRIETKKRFLFVKKTKVEHRCTTNKLSEKYEGSFMQGSEKSISLVQGGRSAYAAALAWEKGSPVPEERVFSDWLESVKENPSVIDFALAPITDLVRNIPCAVTRRNNLRRAFREYAAKFDPCQCARCPNSGRPVLSGTECLCVCQSGTYGENCERRSPDYKSNAVDGNWGCWSSWSSCDATYRRSRTRECNNPAPQQGGKRCEGERRQEEHCTFSIMQNDGQPCISDDEDMKETDLPELESDSGCPQPVPPENGFIRNEKKQYSVGEEVEILCFTGFKAVGYQYFRCLPDRSWRQGDVECQRTECLKPIVPEGLTLSPFQTLYKIGDSIELTCPRGLVVNGPSRYTCSGDSWTPPISDSLSCEKDVLTGLRGHCQPGQKQLGSECVCMSPEEDCGHYSEEICVLDTTSSDYFTSSACKLLAEKCLNNQQLHFLHIGSCEEGPQLKWGLERIKLSSSSTKNESCGYDTCYNWEKCSDTLVSTKRTLFGEMKPFCWSAGAQKQENVPVVEYSIIFLSSSPSLEVSRALCQSSGGRTFI
>sp|Q29RQ1|Q29RQ1_BOVIN Complement component C7 OS=Bos taurus (Bovine) OX=9913 GN=C7 PE=2 SV=1
MKAITLLFLVGFIGEFQVFSSASSPINCQWGSYAPWSECNGCTKTQTRRRSIAVYGQYGGHSCVGSAFETQPCQPTRGCPTEDGCGERFRCFSGQCISKSLVCNGDSDCEEDGADEDRCEDAESRPACDKDKPPPNIELTGRGYNALTGQFRNQVLNTKSFGGQCRKVYSGDGRDFYRLSGNILSYTFQVKINNDFNNEFYNSTWAYVKETSTEHSSSSKGRFLFFSSSSSSHGYSSNTNILTKKKSYQLLVLQNTVEVAQFINNNPEFLQLAESFWKELSYLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYKVIFHMDSEKVKKFDFHSEDKRKCASSHFQFLFTSSKQKCTTMEEVLKSVSENEGNLLRGVPFVRGGHSGFLAGLSYLDLNNPAGNKRRYSQWAGSVPDLPEVIKQKLTPLYELVKEVPCASVKKLYLKRAIEEYLDEFDPCHCRPCHNGGMATVQGSQCQCYCKPKTSGVACEQGVLLGDQAGGVDGGWNCWSSWGPCVQGKKTRSRQCNNPSPSAGGKSCIGETSETRQCEDEELEHLRLLEPHCFPLSLVPTKFCSSPPALKDGFVQDEGATFPVGKNIMYTCKEGYSLVGDPVARCGEDLQWLVGNMHCQKIACVLPALMDGIQSHPHKPFYTIGEKVTISCSGGRSLEGPSTFLCSSSLKWSPEVKDVQCVQREAPLTPKVPKCQPWEKLQNSRCVCKMPYECGSSLGVCARDERSKRILPLTVCKMHVLQCQGRNYTVAGRESCTLPASAEKACGVCPLWEKCDAEGSECVCRAASECEEAGFSVCVEVNGREQTMTECEAGVLRCRGLSISVTGIRPCVAEAA
>sp|A0A3Q1MF14|A0A3Q1MF14_BOVIN Complement factor I OS=Bos taurus (Bovine) OX=9913 GN=CFI PE=1 SV=1
MKLGHVILLLLCFYLSFCEDNFRKRGKSKAVKKSEAHHAPEASLSKETEASSEVKPTSTQDTSQKDFVDKKCLTEKHTHLSCNKVFCQPWQKCIDGTCLCKLPYQCPKNGTRVCSTNGKSYSTYCQQKSFECYRPEAKFLKSGACTGGGQFSVSLSNGKQDSEGIVAVKLADLDTKMFVCGDSWSITEANVACIDRGFQLGALDTHRRDPDPNSAECLHVRCRGLETSLAECTFTKGVHNSEGLAGVVCYTESAAPPKKDSFQCVNGKRIPQKKACDGVNDCVDKSDELCCKDCRGEGFLCKSGVCIPKQYKCNGELDCITGEDEVGCEETGHPEIKEAAEMLTADMDAERKFTKSFLPKLSCGVKNNMHIRRKRVVGGKPAKMGEFPWQMAIKEGDKIHCGGIYIGGCWILTAAHCVRISRMHRYQIWTSFTDWLRPGFQTVVHSVNRIIIHENYNGTTYQNDIALIEMKKRPNEKECVLSKSIPACVPWSPYLFQPNDKCIVSGWGREKDNQKVYSLRWGEVHLINNCSEFYPGRYFEKEMQCAGTDDGSIDACKGDSGGPLVCQDVNNVTYVWGVVSWGENCGKSEFPGVYTKVANYFDWISQHVGRSLISQHNI
>sp|A0A3Q1M2R9|A0A3Q1M2R9_BOVIN Complement factor properdin OS=Bos taurus (Bovine) OX=9913 GN=CFP PE=4 SV=1
MQEVGRGEERRKLRDRGGQESLELKRPAQYPPLPPLLLSHTALRPPSSSCPWFLFSTNSGSRSAHIKPGLLPGGAAGVQCSTCPPKHRPCCCCCCCHCCCSPCQPQVSGWGPNWPPGVPGLLTTLTMLPHPVTGSDPVFCFAQYEESTGKCKDLLGRGVSVEDCCLNAGYAFQKPGSNLCMACRLPQWSPWSAWTPCSVTCTEGSQLRHRHCTGWGEQCFPEKVEPGTFQWQLQACEDQPCCPEMGGWSDWGPWAACSVTCSRGIKIRRRACNRPTPKCGGHCIGEAQESEPCDTKQVCPTHGAWAAWGPWGPCSGTCHGGPSAAVERRSRTCSAPEPSTQPPGNPCSGSPYEQRVCTGLPPCPVAGGWGPWGAVSPCPVTCGLGKIQEQRTCDHPVPQHGGPFCVGDGTRTHVCNTAVHCPVNGQWGLWGEWSNCIRPSIKQISCQEIPGQQTRSRICKGRKFDGQRCVGKQQDIRHCYNIQRCFLQGSWSEWSTWGLCIPPCGPNPIRTRQRLCQATLPKFSPTVTMVEGQGEKNVTFWGKPFVQCDVLQGQKVMVEEKRPCLHVPPCKEP
>sp|F1MVI0|F1MVI0_BOVIN Contactin-1 OS=Bos taurus (Bovine) OX=9913 GN=CNTN1 PE=4 SV=1
MKMWLLFSLLVIISFKTCLSEFTWHRRYGHGVSEEDKGFGPIFEEQPINTIYPEESPEGKVSLNCRARASPFPVYKWRMNNGDIDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPLPERTTKPYPADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENNRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIPTIRWLKNGYSYHRGELRLYDVTFENAGMYQCIAENTHGAIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPTFLWSKGTERLVNSSRILIWEDGSLEINNITRSDGGVYTCFVENNKGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGIGEPSIPSNKIKTDGAAPNVAPSDVGGGGGSNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMRPSTAFQVKVKAFNNKGDGPYSLTAVIHSAQDAPSEAPTAVGVKVLSSSEISVHWEHVVEKIVESYQIRYWASHDKEAAAHRVQVASQEYSARLENLLPDTQYFVEVRACNSAGCGPPSDMIETFTKKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKHSIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGASILSPCLLGFLLPALGILVYLEF
>sp|A7Z067|A7Z067_BOVIN CSF1R protein OS=Bos taurus (Bovine) OX=9913 GN=CSF1R PE=2 SV=1
MGPRTLLILLVVTAWHGQGVPVIEPSGPELVVEPGTAVTLRCTSNGSVKWDGPVSPYWTLDSDAPRSILTTNNATFLHTGTYRCTEPGDPLAGTATIHLYVKDPARPWRVLAEEVTVLEGQDALLPCLLTDPALEAGVSLVRVRGRSVLRQTSYSFSPWYGFTIHKAKFIESQDYECSVRVAGRVVKSLSIRLKVQKVIPGPPTLTLEPEELVRIQGETAKIVCSASDVDVNFDVFLQRGDTKLAISQQSDFRDNRYQKVLTLELDHVGFQDAGNYTCVATNARGVHTTSMVFRVVDSAYLNLTSEQNLLQEVAVGEKLELRVKVEAYPSLQSFNWTYEGPFFGSQPKLNFETTNNTYRYTSKLTLPRLKPSEAGLYSFQARNARGEDTLTFELTLLYPPEVEVMWTLSSGSKALLCEASGYPQPNVTWVQCSSHTNRCDKTHVLVLEEPNPDVLRQEPFHKVTVQSLLTPGTLEHNRTYECRAQNSMGNTSGALGPISVGASMQPRDEPLFTPVLVACMSIMALLLLLLLLLFYKYKQKPKYEVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEAGTGYKNIHLEKKYIRRDSGFSSQGVDTYVEMRPVSTSSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPENIYSIMQACWALEPTRRPTFQQICSLLQEQVQVDRREQDYSNLPSSGSSSSEPEEESSSEHLTCCEQGDIAQPLLQPNNYQFC
>sp|A0A452DIU4|A0A452DIU4_BOVIN C-type lectin domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=CLEC3B PE=4 SV=1
MIVSEGGTRMLGGCSRSSSQVLWLPGLPLFAGFFFWHSRSQLWEGFLDRGPCGHCLKTRSSGPSGQCSLTQATAGSSGSSMELWGPCVLLCLFSLLTQVTAETPTPKAKKAANAKKDAVSPKMLEELKTQLDSLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFVQAKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGSEAEVWLGFNDMASEGSWVDMTGGHIAYKNWETEITAQPDGGKVENCATLSGAANGKWFDKRCRDKLPYVCQFAIV
>sp|A2VE41|A2VE41_BOVIN EGF containing fibulin extracellular matrix protein 1 OS=Bos taurus (Bovine) OX=9913 GN=EFEMP1 PE=1 SV=1
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETPAAEGAGAAANAAATSSTGTGGVAATGVAASGVVPGGGFVASAAAEVQTGRNNFVTRRNPSDPQRIPINPSHRIQCATGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQCVDVDECTIPPYCHQRCVNTPGSFYCQCNPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRGRTCQDINECETTNECREDEMCWNYHGGFRCYPRNPCQDPYVLTSENRCVCPVSNAMCREIPQSIVYKYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVDLEMVTVNSIGTFRTSSVLRLTIIVGPFSF
>sp|A0A3Q1M5Q6|A0A3Q1M5Q6_BOVIN Extracellular matrix protein 1 OS=Bos taurus (Bovine) OX=9913 GN=ECM1 PE=4 SV=1
MGTMSGAALVLACLTVASVASDGGFKASGQRELGPQPLTHPLQQVGYAAPPSPPLSRALPQGHPRTSQHSLHSEGQSEVQPSPSQDAIPLQEELPAPQLPVEKKGGPPFPQEAIPLQEELPASQLPVEKKGGPPLPQEAIPLQEELPPPQVPIEQKEEKPAPSMDHSPPEPESWNPAQHCQHGRPRGGWGHRLDGFPPGRPSLDNLDQICLPSRQHVVYGPWNLPQTGFSHLSRQGETLNLLETGYSRCCRCRNRTNRLDCAELVWEDSVTRFCEAEFSVKTQPHGCCKKQGEARLSCFQEEAPRPHYQLRACPSHQPGISLGPELPFPPGLPTVDNIKNICHLKRFRSVPRNLPATDSIQRQLQALTRLEAEFQRCCRQGNNHTCTWKAWEDTLDGYCDWEQAIKTHHHSCCNYPPSPLRDKCFARRAPYPNYDRDILTLDLSRITPNLMNHLCGNRRVLSKHKQIPGLIQKVTARCCDLPFPEQACCAEEEKSAFIDELCGSRRNFWRDSALCCKLSPGDEQINCFNTKYLRNVAVVTGDTRDAKGPGEQGPTQGTNSSPTSEPKEE
>sp|P80425|P80425_BOVIN Fatty acid-binding protein, liver OS=Bos taurus (Bovine) OX=9913 GN=FABP1 PE=1 SV=1
MNFSGKYQVQTQENYEAFMKAVGMPDDIIQKGKDIKGVSEIVQNGKHFKFIITAGSKVIQNEFTLGEECEMEFMTGEKIKAVVQQEGDNKLVTTFKGIKSVTEFNGDTVTSTMTKGDVVFKRVSKRI
>sp|F1N0K0|F1N0K0_BOVIN Fibrillar collagen NC1 domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=COL11A1 PE=4 SV=3
MERWSSRWKTKRWLWDFTITTLALTFLFQAREVRGADPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGSDTAYRVSKQAQLSAPTKQLFSGGTFPEDFSILFTIKPQKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLYEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSEKAIVDTNGIMVFGTRILDEEVFEGDIQQLLIIGDPKAAYDYCEHYSPDCDSSAPEAAQAQEPQVDEKKKFSFKMKMKTVATNSKKKSKKFTPPKSEKFASKKKKTYQAAAMAKLGVKANIVDDFQEYNYGTESYQTEAPRSVSGSNEPNPVEEVFTEEYLTGEDYDSQRKNSEDMLYENKQIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPTNEEFGPGVPAETDITETSINGHGAYGEKGQKGEPAVVEPGMLIEGPPGPAGPAGLMGPPGLQGPTGPPGDPGERGPPGRPGLPGADGLPGPPGTMLVLPFRYGGDSSKGPTVSAQEAQAQAILQQARIALRGPPGPMGLTGRPGPVGGPGSSGAKGEMGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGEDGIRGEDGEIGPRGLPGEAGPRGLLGPRGTPGPIGQPGIAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKPGLAGLPGADGPPGHPGKEGQSGEKGSLGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPPGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGVSGKDGPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGGVGEKGEPGEAGNPGPPGEAGTGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGPPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGAEGRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPLGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGIPGPAGPIGPPGPPGLPGPQGPKGTKGSTGPAGQKGDSGLPGPPGPPGPPGEVIQPLPILSPKKTRRHAESTQADAGDNILDYNDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDIEGNSINMVQMTFLKLLTASARQNFTYYCHQSVAWYDMSSGSYDKALRFLGSNDEEMSYDNNPYIKALFDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCFLG
>sp|F6QND5|F6QND5_BOVIN Fibrinogen C-terminal domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=FGA PE=4 SV=1
MGTGRGGSLPFFQLGAPLESALSTAEMFSVRDLCLVLSLVGAIKTEDGSDPPSGDFLTEGGGVRGPRLVERQQSACKETGWPFCSDEDWNTKCPSGCRMKGLIDEVDQDFTSRINKLRDSLFNYQKNSKDSNTLTKNIVELMRGDFAKANNNDNTFKQISEDLRSRIEILRRKVIEQVQRINVLQKNVRDQLVDMKRLEVDIDIKIRSCKGSCSRALEHKVDLEDYKNQQKQLEQVIAINLLPSRDIQYLPLIKMSTITGPVPREFKSQLQEAPLEWKALLEMQQTKMVLETFGGDGHARGDSVSQGTGLAPGSPRKPGTSSIGNVNPGSYGPGSSGTWNPGRPEPGSAGTWNPGRPEPGSAGTWNPGRPEPGSAGTWNPGRPEPGSAGTWNPGRPEPGSAGTWNTGSSGSSSFRPDSSGHGNIRPSSPDWGTFREEGSVSSGTKQEFHTGKLVTTKGDKELLIDNEKVTSGHTTTTRRSCSKVITKTVTNADGRTETTKEVVKSEDGSDCGDADFDWHHTFPSRGNLDDFFHRDKDDFFTRSSHEFDGRTGLAPEFAALGESGSSSSKTSTHSKQFVSSSTTVNRGGSAIESKHFKMEDEAESLEDLGFKGAHGTQKGHTKARPARDCYDVLQTRPSGAQSGIFSIKLPASSKIFSVYCDQETGLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNEYLHLLTLRGSILRVELEDWAGKGAYAEYHLRVGSEAEDYALEVSSYKGTAGDALIEGSVEEGTEYTSHTGMRFSTFDRDADKWEDNCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRDNSPYEIENGVVWVPFRGADYSLRAVRMKIRPLVTQ
>sp|A0A3Q1MG04|A0A3Q1MG04_BOVIN Fibrinogen C-terminal domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=FGB PE=4 SV=1
MDFSHALQNLISCNFEKFKTMKHLLLLLFCAFIVQAQFPTDYDEGQDDRPKVGLGARGHRPYDKKKEEAPSLRPVPPPISGGGYRARPATATVGQKKVERKPPDADGCLHADPDLGVLCPTGCKLQDTLVRQERPIRKSIEDLRNTVDSVSRTSSSTFQYITLLKNMWKGRQNQVQDNENVVNEYSSHLEKHQLYIDETVKNNIPTKLRVLRSILENLRSKIQKLESDVSTQMEYCRTPCTVTCNIPVVSGKECEEIIRNGGETSEMYLIQPEDSSKPYRVYCDMKTEKGGWTVIQNRQDGSVDFGRKWDPYKQGFGNIATNAEGKKYCGVPGEYWLGNDRISQLTNMGPTKLLIEMEDWKGDKVTALYEGFTVQNEANKYQLSVSKYKGTAGNALIEGASQLVGENRTMTIHNSMFFSTYDRDNDGWKTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGAYTWDMAKHGTDDGVVWMNWQGSWYSMKKMSMKIRPYFPEQ
>sp|P12799|P12799_BOVIN Fibrinogen gamma-B chain OS=Bos taurus (Bovine) OX=9913 GN=FGG PE=1 SV=1
MSWSSHPPSVIFYILSLLSSACLAYVATRDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGILYQVENKTSEARELVKAIQISYNPDQPSKPNNIESATKNSKSMMEEIMKYETLISTHESTIRFLQEVYNSNSQKIVNLRDKVVQLEANCQEPCQDTVKIHDVTGRDCQDVANKGAKESGLYFIRPLKAKQFLVYCEIDGSGNGWTVFQKRLDGSLDFKKNWIQYKEGFGHLSPTGTGNTEFWLGNEKIHLISTQSSIPYVLRIQLEDWNGRTSTADYASFKVTGENDKYRLTYAYFIGGDAGDAFDGYDFGDDSSDKFFTSHNGMQFSTWDSDNDKYDGNCAEQVGIGWWMNKCHAGHLNGVYYQGGTYSKTSTPNGYDNGIIWATWKSRWYSMKKTTMKIIPLNRLAIGEGQQHQLGGAKQVGVEHHVEIEYD
>sp|G5E5A9|G5E5A9_BOVIN Fibronectin OS=Bos taurus (Bovine) OX=9913 GN=FN1 PE=4 SV=2
MGARSAAAAAAGGWEGVRPVPPPRRPGPRGGREGTVPYKPWFSGLGRSRRLRFARGGGGALVASGDEGTCSHNFFRPLLPLCPSTLPLPHHPALTLLEVLEGDSARRLRREPNLSGKLPHRLKMLGGPGPGLLLLLAVLSLGTAVPSAGASKSRRQAQQIVQPQSPLTVSQSKPGCYDNGKHYQINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDQAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQTTSAGSGSFTDVRTAIYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGKTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWACQPLQTYPDTSGPVQVIITETPSQPNSHPIQWSAPESSHISKYILRWKPKNSPNRWKEATIPGHLNSYTIKGLRPGVVYEGQLISVQHYGQREVTRFDFTTTSTSPAVTSNTVTGETTPLSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYTVNVYEISEEGEQNLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPRAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGVPRSDKVPPPRDLQFVEVTDVKITIMWTPPESPVTGYRVDVIPVNLPGEHGQRLPVSRNTFAEVTGLSPGVTYHFKVFAVNQGRESKPLTAQQATKLDAPTNLQFINETDTTVIVTWTPPRARIVGYRLTVGLTRGGQPKQYNVGPAASQYPLRNLQPGSEYAVSLVAVKGNQQSPRVTGVFTTLQPLGSIPHYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIVVSGLTPGVEYVYTISVLRDGQERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWAPPSSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTALDSPSGIDFSDITANSFTVHWIAPRATITGYRIRHHPENMGGRPREDRVPPSRNSITLTNLNPGTEYVVSIVALNSKEESLPLVGQQSTVSDVPRDLEVIAATPTSLLISWDAPAVTVRYYRITYGETGGSSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPVSINYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTAPKNGPGPSKTKTVGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEETAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTNLKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPIQRTIRPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTGNGIQLPGTSGQQPSLGQQMIFEEHGFRRTTPPTTATPVRHRPRPYPPNVNEEIQIGHVPRGDVDHHLYPHVVGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEAVKDQQRQKVREEVVTVGNSVDQGLSQPTDDSCFDPYTVSHYAIGEEWERLSDSGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAEPGNEGSTAHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
>sp|A0A3Q1MJB2|A0A3Q1MJB2_BOVIN Fibulin-1 OS=Bos taurus (Bovine) OX=9913 GN=FBLN1 PE=1 SV=1
MERAAPSRRVPLLLLLLGGLSLLAAPAGADVSMEACCADGHRMATEHRACSLPYTSESKECRMVQEQCCQNQLEELHCATGINLANEQDSCATPRGDNTSLEAMFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGLVFRACCVKGQETADFAPGDGGDLQETAKVSEIEEEQEDPYLNDRCRGGGPCKQQCRDTGEEVVCSCFVGYQLLPDGVSCEDVNECITGGQSCRLGETCVNTAGSFRCQRDSSCGTGYELTEDNDCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPVGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECSPPSEPCGPGHLCVNSPGSFRCECKAGYYFDGISRTCVDINECRRYPGRLCGHKCENTPGSYYCSCTLGFRLSSDGRSCEDVNECNSNPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPPTGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGSFRCLAFECPENYRRSTDALRQEKTDTVRCIKSCRPNDVACVLDPVHTISHTVVSLPTFREFTRPEEIIFLRAITPAYPANHADIIFDITDGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVSVHIFVSEYWF
>sp|F1N169|F1N169_BOVIN Filamin A OS=Bos taurus (Bovine) OX=9913 GN=FLNA PE=1 SV=3
MSSSHSRAGQSAAGAVLGIGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPAGQKGTVEPQLEARGDSTYRCSYQPSVEGVHMVHVTFAGVPIPRSPYTVTVGQACNPGACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKSAEFTVDAKHGGKAPLKVQVQDNEGCPVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELSKPTHFTVNTKAAGKGKLDVQFSGPAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGINVTYGGDAIPKSPFSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVLSKIVGPSGAAVPCKVEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFSLEAVPPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDPSKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSEAGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGIQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYVPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGMAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTAQPSLRPQQLAPPYTYAQGGQQTWAPERPLVGVNGLDVSSLRPFDLVIPFTIKKGEVTGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPAIFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGITGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIAGSPFKARVTGHRLVSNHSLHETSSVFVDSLTKTATIPQHSAPGPGPTDASKVLAKGVGLSKAYMGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVLVP
>sp|Q2TBU0|Q2TBU0_BOVIN Haptoglobin OS=Bos taurus (Bovine) OX=9913 GN=HP PE=2 SV=1
MSALQAVVTLLLCGQLLAVETGSEATADSCPKAPEIANSHVEYSVRYQCDKYYKLHAGNGVYTFNNKQWINKDIGQQLPECEEDDSCPEPPKIENGYVEYLVRYQCKPYYTLRTCGDGVYTFNSKKQWINKNIGQKLPECEAVCGKPKHPVDQVQRIIGGSLDAKGSFPWQAKMVSQHNLISGATLINERWLLTTAKNLYLGHSSDKKAKDITPTLRLYVGKNQLVEVEKVVLHPDHSKVDIGLIKLRQKVPVNDKVMPICLPSKDYVKVGRVGYVSGWGRNENFNFTEHLKYVMLPVADQDKCVKHYEGVDAPKNKTAKSPVGVQPILNENTFCVGLSKYQDDTCYGDAGSAFVVHDKEDDTWYAAGILSFDKSCAVAEYGVYVKVTSILDWVRKTIANN
>sp|E1BDW7|E1BDW7_BOVIN Hepatocyte growth factor-like protein OS=Bos taurus (Bovine) OX=9913 GN=MST1 PE=3 SV=2
MGWLPLLLLLIWFSGAPGQRSPLNDFQVLRGTELQHLLHSVGPGPWQEDVANAEECAGLCGPLLDCRAFHYNLSSHGCQLLPWTQHSPHTRLQRSGRCDLFQKKNYVRTCIVDNGVEYRGTVAITVGGLPCQRWSHRFPNDHKFTPTLRNGLEENFCRNPDRDPGGPWCYTTDPAVRFQSCGIKSCREATCLWCNGEDYRGSVDSTESGRECQRWDLQHPHPHPFEPGFWTKIWTTTIAGIRTARSGPGAIPPTRRWRESSATSPAAVQRSEAQPSQEATTLNCFRGKGEGYRGTVNTTAAGVPCQRWDAQLPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRMAFCYQIRRCTDDVRPEDCYHGAGELYRGSVSKTRKGIRCQNWSAETPHKPQFKHTSAPHTPLEENFCRNPDGDSHGPWCYTTDPGTPFDYCALRRCDDDQQPSILETAHQVLFDKCGKRVTRVDPLHSKLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHMSLVGYEVWLGTLFQDPQPGEPDLQHIPMAKMVCGPSGSQLVLLKLERPVILNQRVALICLPPERYVVPPGTRCEIAGWGETKGTGDDTVLNIALLSVISNQECNVKHRGRVRESEMCTAGLLAPVGACEGDYGGPLACFTHDCWVLQGIIIPNRVCARPRWPAIFMRVSVFVDWIHKVMRLG
>sp|F1MKS5|F1MKS5_BOVIN Histidine-rich glycoprotein OS=Bos taurus (Bovine) OX=9913 GN=HRG PE=4 SV=3
MKVLTAALLSILLITQQCSCAVNPTGCDAVEPVAVRALDLINKGRWDGYLFQLLRVADAHLDKVESIAVYYLVLDVKESDCPVLSRKHWDDCELNVSRRPSETVIGQCKVIAITLLAGPEDLRVNDFNCTTSSVSSALTNTIDSPVLFDFFEDTELYRKQAEKALEKYQRENSDFAPFRVDKVKRAMRARGGEGTSYFLDFSVRNCSSHHFPRHSHIFGFCRADLFYDVEASDLETPKDIVTNCEVFNLKEHRNFSAVQHHLGRPFHSGEHEHSPAGRPPFKPSGSKDHGHPHESYNFRCPPPLEHKNHSDSPPFQARAPLPFPPPGLRCPHPPFGTKGNHRPPHDHSSDEHHPHGHHPHGHHPHGHHPHGHHPHGHQPHGHHPHGHHPHGHHPHGHHPHGHHPYGHHPHGHHPHDNDFYDHGPCDPPPHRQDPQDHHRQGRDPPPRHSKERGPGKGHFRFHWRPTGYIHRLPSLKKGEVLPLPEANFPSFSLPNHNNPLQPEIQAFPQSASESCPGTFNIKFLHISKFFAYTLPK
>sp|G3N1H5|G3N1H5_BOVIN Ig-like domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=LOC100300716 PE=4 SV=2
VTLICSKMNPLWTLLFVLSAPRGVLSQVQLRESGPSLVKPSQTLSLTCTISGFSLSSYAVGWVRQAPGKALEWVGGISSGGSTCLNPALKSRLSITKDNSKSQVSLSVSSVTTEDTATYYCAKDTVRGRQCEPRQKPPCIGARDHQGARRTQYRAESWSRCRRGVGW
>sp|A0A3Q1M667|A0A3Q1M667_BOVIN Ig-like domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000053508 PE=4 SV=1
MTSKGRKTRVTWTGHPSEWGHTLVFFAPGGITPLMTLMTALPTPGVLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSSYGVGWVRQAPGKALECLGGISSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTATYYCAKDTVRGSQCEPRQKPPCIGARDHQGARSTHSELSPGAGAEEALGGGGPGGDSPQRFSFLLLPRSCTSNPLLCPGNSLCFMSLSENCVYIYFNFSLKQG
>sp|A0A3Q1LSF0|A0A3Q1LSF0_BOVIN Ig-like domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000050373 PE=4 SV=1
MAWSPLLLTLVALFTGSWAQAMLTQPPSVFGTLGQRRVSITCSGSSNNIGRYGVGWYQQVPGSGLRTIIYGSSSRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYFCATGDYSSSTVTVLQARGEVRQKPALPKSRASRG
>sp|A0A452DK44|A0A452DK44_BOVIN Ig-like domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=AZGP1 PE=3 SV=1
MVPVLLALLLLLGPAVSEETQAGNYSLSFLYTGLSKPREGFPSFQAVAYLNDQPFFHYNSEGRRAEPLAPWSQVEGMEDWEKESALQRAREDIFMETLSDIMDYYKDREGSHTFQGAFGCELRNNESSGAFWGYAYDGQDFIKFDKEIPAWVPLDPAAQNTKRKWEAEAVYVQRAKAYLEEECPGMLRRYLPYSRTHLDRQESPSVSVTGHAAPGHKRTLKCLAYDFYPRSIGLHWTRAGDAQEAESGGDVLPSGNGTYQSWVVVGVPSEDQAPYSCHVEHRSLTRPLTVPWDPRQQAE
>sp|A0A3Q1LUE9|A0A3Q1LUE9_BOVIN Ig-like domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000050515 PE=1 SV=1
MSTMAWSPLLLTLVALCTGSWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGRGNYVNWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCAAYDSSSNNGTVLQARGEVRQKPALPQVMGLPGLKHLLPEQPLLLFA
>sp|Q3SYR8|Q3SYR8_BOVIN Immunoglobulin J chain OS=Bos taurus (Bovine) OX=9913 GN=JCHAIN PE=1 SV=1
MKNCLLFWGVLAIFVMAVLVTAQDENERIVVDNKCKCARITSRIIPSAEDPSQDIVERNVRIIVPLNSRENISDPTSPMRTKFVYHLSDLCKKCDTTEVELEDQVVTASQSNICDSDAETCYTYDRNKCYTNRVKLSYRGQTKMVETALTPDSCYPD
>sp|Q09TE3|Q09TE3_BOVIN Insulin-like growth factor binding protein acid labile subunit OS=Bos taurus (Bovine) OX=9913 GN=IGFALS PE=2 SV=1
MAPSRAPLPAGVPALVVLLVSWAALGPHGLEGVEPVAPADPEGLQCPAVCSCGHDDFTDELSVFCSSRNLTQLPGGLPPGTRALWLDGNNFSSIPAAAFRNLSGLGFLNLQGSGLASLEPQALLGLRGLCHLHLEHNRLHALAAHTFLHTPGLASLGLSNNLLSRLDEGLFRGLAHLWDLNLGWNSLTVLPDTAFQGLAGLRELVLAGNKLAYLQPALFCGLGELRELDLSRNTLRSVKANVFVKLPKLQKLYLDHNLVAAVAPGAFLGMKALRWLDLSHNRVGSLLEDSFPGLLGLHVLRLSHNALAGLRPRTFKDLHFLEELQLGHNRLRQLPEEAFAGLGQLEVLALNDNQLQELRPGGFLGLRNLAVLNLSSNCLRDLPERAFQGLAKLHSLHLEGGCLARLGPLAFAGLSGLRRLFLKGNSIADVDERSLGGLAELLELDLTANQLTHLPGRLFQDLGRLEYLLLARNRLSALPADALGPLQRTFWLDVSHNRLEALPAAALAPLSRLRFLSLRNNSLRTFAPQPPGLERLWLEGNPWDCSCALGALRAFALQQPASVPRFVQALAEGNDDRQPPVLAYNNITCASPPSLAGLDLRDVGEAHFAHC
>sp|P13384|P13384_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus (Bovine) OX=9913 GN=IGFBP2 PE=1 SV=2
MQPRLGGPALLLLPPLLLLLLLGAGGGDCGARAEVLFRCPPCTPESLAACKPPPGAAAGPAGDARVPCELVREPGCGCCSVCARLEGERCGVYTPRCGQGLRCYPNPGSELPLRALVHGEGTCEKHGDAEYSASPEQVADNGEEHSEGGLVENHVDGNVNLMGGGGGAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQGARGVHTQRMQ
>sp|Q0VCM5|Q0VCM5_BOVIN Inter-alpha-trypsin inhibitor heavy chain H1 OS=Bos taurus (Bovine) OX=9913 GN=ITIH1 PE=1 SV=1
MGLRGLLCVCLVSLLALQAVAAQGSPTRNPKGGKKRMAVDAAVDGVVIRSLKVNCKVTSRFAHYIITSQVVNSADTAKEVSFNVEIPKTAFISDFAITADENAFTGDIKDKVTAWKQYRKAAISGENAGLVRASGRTMEQFSIHIIVGPRSKATFRLTYEEVLRRKLMQYDIVIKVKPQQLVQHFEIDVDIFEPQGIRKLDVEASFLPKELAAQLIKKSFSGKKGHVLFRPTVSQQQTCPTCSTTLLNGDFKVTYDVNRDDACDLLVANNYFAHFFAPQNLKKLNKNVVFVIDISSSMEGQKLKQTKEALHKILGDMRPGDYFDLVLFGSAVQSWKGSLVQASPANLEAARNFVQQFSLAGATNLNGGLLRGIEILNKAQQSLPELSNHASILIMLTDGEPTEGVMDRTQILKNVRDGIKGRFPLYNLGFGHDVDLNFLEVMSLENNGRVQRIYEDHDATQQLQGFYEQVANPLLRDVELLYPREAVSDLTQHRHKQYYEGSEIMVAGRIADHKLSSFKADVRAHGEGQEFMTTCLVDKEEMKKLLRERGHMLENHVERLWAYLTIQELLAKRMKLEGQEKANVSAKALQMSLAYQFVTPLTSMTVRGMTDQDGLEPIIDKPLDDYLPLEMVGPRKTFMLQASQPAPTHSSLDIKKLPDQVTGVDTDPHFLIHVPQKEDTLCFNINEEPGVVLSLVQDPDTGFSVNGQLIGNEAGSPGKHEGTYFGRLGIANPATDFQLEVTPQNITLNPGSGGPVFSWRDQAFLRQNEVLVTINRKRNLVVSVEDGGTFEVVLHRVWRGSAVRQDFLGFYVLDSHRMSARTHGLLGQFFHPFDYKVSNLHPGSDPTKTDATMVVKNRRLTVTRGLQKDYRKDPRHGAEVTCWFIHNNGDGLIDGIHTDYIVPDIF
>sp|E1BFL8|E1BFL8_BOVIN Interleukin 1 receptor accessory protein OS=Bos taurus (Bovine) OX=9913 GN=IL1RAP PE=4 SV=3
MGLLWCVMSLYFYGILQSHASERCDDWGLDTMRQIQVYEDEPARIKCPLFEHFLKYNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDNCFNSPMKLPVHKLYLEYGVQKISCPNIDGFFPSNIKPNITWYMGCRKIHNFNNVLPEGMNLSFIIAMVSNNGDYTCVVTYPENGRTFTLTRTQTVKVVGSPNDAMPPHIYSPDDHVVYEKEPGEELLIPCKVYFSYLKDSRNEIWWTIDGKKPEDTTIDVSVNESVILKVTEDETRTQLLSIKKVTAEDLKRNYVCHARNAKGEVDRAANVKQKAPRYTVELACGFGATVLLVVILIVIYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGNTVEAVFDFIQRSRRMIVVLSPDYVTEKSISMLEFKLGVMCQNSIATKLIVVEYRPLEQPHPSILQLKESVSFVSWKGEKSKHSGSKFWKALRLALPLRSLSASSGWNESCSSQSDISLDHVQRRKSRLKEPPELQSSGRAAGASPGPDTMSKHRGKPSAACRCCVTYCEGESQLRSKSRAEIHTQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDFYIL
>sp|A5D7R6|A5D7R6_BOVIN ITIH2 protein OS=Bos taurus (Bovine) OX=9913 GN=ITIH2 PE=1 SV=1
MKGLTCFFLCFFLSESRGFEIPTNGLSEFADYGDHVELAPGKFQFVPENRRYQRSISGESGERTEDVDQVTVYSYKVQSTITSRVANTVIQTKVVNHSPQPQNVVFDVQIPKGAFISNFSMTVDGTTFTSSIKEKTVGRALYAQARAKGKTAGLVRSRALDMEDFKTEVSIAPGAKVQFELHYQEVKWRKLGSYEHRLHLKPGRLAKHLEVDVRIIEPQGLRSLHVLDTFDGHFDGVPVVSKGPQKAHIAFKPTVAQQRKCLNCSETMVDGELVVMYDVNREEKVGELEVFNGYFVHFFAPENMDPIPKNILFVIDVSGSMWGIKMKQTVEAMKTILDDLRTEDHFSVVDFNHNVRTWRNDLVSATKTQVADAKNYIEKIQPSGGTNINEALLRAIFILNEANNLGMLDPNSVSLIILVSDGDPTVGELKLSKIQKNVKQNIRDNISLFSLGIGFDVDYDFLKRLSNDNRGIAQRIYGNQDTSVQLKKFYNQVSTPLLRNVQFNYPQPSVTDVTQNSFHNYFGGSEIVVAGKVDPEKLGQLQSIITATSANAELVLETLAEMDGLEDFLSKDKHADPDFTKKLWAYLTINQLLAERSLAPTAAMKRKITKTILQMSLDHHIVTPLTAMVIENEAGDERMLADSPPQDHSCCSGALYHGSKVSPNSVPSWVNPSPAPVLPMPAVGAQVLESTPPPHVMRVENDPHFIIYLPKSQKNICFNIDSEPGKILNLVSDPELGILVNGQLVGAKKPKNKKLSTYFGKLGFYFQREDVKVEISTETISLSRGSRTSVLSWSDTAHVLNQRVLVSVKKEKTVTVTLDKEMFFSVLLHRVWKKHPINVDFLGIYIPPTNKFSPNVHGLIGQFMNEPKIHVFNERPGKDPEKPEASMEVKGQKLVVTRGLQKDYRTDRVFGTDVPCWFVHNSGKGFIDGHYKDYFVPQLYSFLRRP
>sp|A0A140T8C8|A0A140T8C8_BOVIN Kininogen-1 OS=Bos taurus (Bovine) OX=9913 GN=KNG1 PE=4 SV=1
MKLITILFLCSRLLPSLTQESSQEIDCNDQDVFKAVDAALTKYNSENKSGNQFVLYRITEVARMDNPDTFYSLKYQIKEGDCPFQSNKTWQDCDYKDSAQAATGECTATVAKRGNMKFSVAIQTCLITPAEGPVVTAQYECLGCVHPISTKSPDLEPVLRYAIQYFNNNTSHSHLFDLKEVKRAQRQVVSGWNYEVNYSIAQTNCSKEEFSFLTPDCKSLSSGDTGECTDKAHVDVKLRISSFSQKCDLYPVKDFVQPPTRLCAGCPKPIPVDSPDLEEPLSHSIAKLNAEHDGAFYFKIDTVKKATVQVVAGLKYSIVFIARETTCSKGSNEELTKSCEINIHGQILHCDANVYVVPWEEKVYPTVNCQSLGQTSLMKRPPGFSPFRSVQVMKTEGSTTVSVPHSAMSPVQDEERDSGKEQGPTHGHGWDHGKQIKLHGLGLGHKHKHDQGHGHHRSHGLGHGHQKQHGLGHGHKHGHGHGKHKNKGKNNGKHYDWRTPYLASSYEDSTTSSAQTQEKTEETTLSSLAQPGVAITFPDFQDSDLIATVMPNTLPPHTESDDDWIPDIQTEPNSLAFKLISDFPETTSPKCPSRPWKPVNGVNPTVEMKESHDFDLVDALL
>sp|G3MZT8|G3MZT8_BOVIN Latent transforming growth factor beta binding protein 4 OS=Bos taurus (Bovine) OX=9913 GN=LTBP4 PE=4 SV=2
MRLPGPSGRRPLLLVLLLPLLAAAATAASAAGPSTSQAVEVASLAVSEASCRVRSCRPEKCAGLQRCLAPGPPELQSASPSVRKRQVSLNWQPLTLQEARALLRRRRPRGPGARALLRRRPPQRAPAGQSRVLCPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAMPGFTRSVYTMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQVERVSGPWEEADAEAVARAEAAARSEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGVHDCQSCSELLGNTHQGGAPDGPCPTGFERVNGSCEDVDECATRGRCQHGECANTHGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRPLGQEPPRVSLSQPRAPPSTSRPPSGSPKKGEMIRDTQIKVSNADTPSLPGFLPTHRPEPRPEPRPGPELPLPSIPAWTGPGIPESGPSAGECQRNPQVCGRGRCIPRPSGYTCACDSGFRLSPQGTHCIDVDECRRVPTPCAPGRCENTPGSFRCVCGPGFRAGPRGTECLDVDECHRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECIQSPGLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTVGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCAYGRCENTEGGFQCVCPTGFQPNAAGSECEDVDECENHLACPGQECVNSPGSFQCRACPAGHHLHHGRCTDVDECSSGASCGPHGHCTNTEGSFHCSCEPGYRAPVGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDIDECQEYGPAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCPLVSPGTFPGAQPHAPASPSLPARPPPPPPPRRPSPPRQGPVSSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQCPSTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHAQRLECIDNDECADEEPACEGGRCVNTIGSYHCTCEPPLVLDGSRRRCVSNESQSLDDNLGVCWQEVGADLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVLRPPAYGPPRPGGFGLPYEYGPDLGPPYQGLPYGPELYPPPVLPYDPYPPPPGPFARREAPYGTPPFDMPDFEDDGGPYGESEAPAPSGPGTRWRYRSRDTRGSFPEPEESPEGGSYAGAQAGRYEGLEAEECGILDGCAHGRCVRVPEGFTCDCFDGYRLDMTRMSCVDINECDEAEAAAPLCVNARCVNTDGSFRCICRPGFAPSHEPHHCTPARPRA
>sp|E1BGJ0|E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus (Bovine) OX=9913 GN=LRP1 PE=1 SV=3
MLTPPLLLLLPLLSALVAAAVDVPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCILMSRLCNGVQDCADGSDEGSHCREQRGQCSHLGCQHHCVPTLNGPTCYCNNSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEYTINISLSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNSDNANAQQKTSVIRVNRFNSTDYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGTGGAAPIVTLLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGVTCLANPSYVPPPQCQPGEFACSNSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHNDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPGEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLIDYNRTVSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSGQRGPVGLAIDFPESKLYWISSKNHTINRCNLDGSELEVIDAMRNQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSGSVVLRNSTTLVMHMKVYDESIQLDHEGTNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGSERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGEDREVVLSSNNMDMFSVSVFEEFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVDNGGCQQLCLYRGNGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSVHLSDERNLNAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVENVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIPQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDFTCQAVNSSCRAQDEFECANGECINFGLTCDGVSHCKDKSDEKPSYCNTRRCKKTFRQCNNGRCVSNMLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVRFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAAHCEGKTCGPGSFSCPGTHVCVPERWLCDGDKDCADGADESVAAGCLYNSTCDDREFMCQNRQCIPKHFMCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQWECDGENDCHDQSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERGCHINECLSHKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADMDECSTTFPCSQRCINTHGSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSRSVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDAVPNHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGGDGRNCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAQTSHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSMDPKLTSCATNASICGDEARCVRTEKAAYCACRTGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPSHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVAVPSPTPPPDAPRPGTCNLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSDYCENFGTCQMAADGSRQCRCTAYFEGPRCEVNKCSRCLDGACVVNKQSGDVTCNCSDGRVAPSCLTCIGHCSNGGSCTMNSKMMPECQCPPHMAGPRCEEQVVGQQQPGHVASILIPLLLLLLMLLVAGVVFWYKRRVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
>sp|F1MGK8|F1MGK8_BOVIN LIFR_D2 domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=OSMR PE=4 SV=3
MALFAVLQTTFLLALLPLRTYQSEVLSEPLPLTPESLNVSINSTKQCMHLQWTVHNPDYHQEFKMVFQIQISRFKASNVIWLENYSTTVKRNQVLHWSWESELPLECAIHFVRMRTMVDDARIPAPRLWSNWSSWEKADAQNSLGDHPLYVFPKDKLVEEGSNVTVCYISMNHQDNISCYLEDVLIYGRQLDQNVWAFEFKNVSFIRKTGTNFYCKGQGDPEGVVLLVSKVLEEPKNFSCETQDLKTLTCTWDPGNDTGLIQLPSYTLFESFSGKKTLCKHRNRCDWQVTQDSQEMYNFTLVAENYFRKRSVSILFNLIHGVHPMAPYSLFPKSVSATNATVTWKVYSIGSSSALLCQLQLLGEEK
>sp|A0A3Q1MSW9|A0A3Q1MSW9_BOVIN Lipocln_cytosolic_FA-bd_dom domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=RBP4 PE=3 SV=1
MGARDGCDEGLGAGGMGTQGSGGRRAPRGQDGAWGPVLEGRVVQPPGAHGARFPQGGLPSEMEWVWALVLLAALGSARAERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQKIVRQRQEELCLARQYRLIPHNGYCDGKSERNIL
>sp|F1MNN7|F1MNN7_BOVIN Lipopolysaccharide-binding protein OS=Bos taurus (Bovine) OX=9913 GN=LBP PE=4 SV=2
MVTSTGTLPSLLLGTLLTFTSGALGANPGLVVRITDQGLEYVAQEELLALQSKLHKVTLPDFNGDVRIKHFGSVDYRFHSLNIQSCKLLGSALKLLPNQGLHFSISDSFIQVTGDWKVRKRILRLDGSFDVKVKGITISVNLLLDSEPSGRPKVAVSSCSSHIRDVEVHISGDLGWLLNLFHNQIESRFRRVLESKICEIIEDSVTSELQPYLQTLPVTTEIDHLAGLDYSLMGAPQATAQMLDVMFKGEIFSRDDRFPVAFLAPVMNLPEEHSRMVYFAISDYAFNTASLVYHKAGFLNFTITDDVIPPDSSIRLNTKSFRAFVPRIARLYPNTNLELQGAVISAPCLNFSPGNLSTAAQMEIEAFVLLPNSVKEPVFRLSVATNVSAMLTFNTSKITGFLEPGKIQVELKESKVGRFNVELLEALLNYYLLNNFYPKVNDKLAEGFPLPLLRKIQLYDPILQIHKDFLFLGTNVRYLRV
>sp|A0A3Q1LY19|A0A3Q1LY19_BOVIN L-lactate dehydrogenase OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000016688 PE=3 SV=1
MATLKDQLIQNLLKEEHVPQNKITIVGVGAVGMACAISILMKDLADEVALVDVMEDILKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEQWKAVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTHEEEACLKKSADTLWGIQKELQF
>sp|Q5E9B1|Q5E9B1_BOVIN L-lactate dehydrogenase B chain OS=Bos taurus (Bovine) OX=9913 GN=LDHB PE=2 SV=4
MATLKEKLIAPVAEEETRIPNNKITVVGVGQVGMACAISILGKSLTDELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDEEVAQLKKSADTLWGIQKDLKDL
>sp|F6RMV5|F6RMV5_BOVIN LRRCT domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=LRG1 PE=1 SV=1
MKKREATMSSQNPERKQSLVGWDSHLSRIFLLLLFVVSAQGLTPNPEACLVFSSVNGSSISCQPPAQIPHSLPADTIFLAVEFFNLTQLPADFLQGVPNLQELHLSSNRLEDFSPKFLLPVPQLKVLDLTRNSLTGLFPGFFRVSAALCTLVLKGNQLKFLEASWLHGLKALRHLDLSENQLHSLPPGLLENFTDLLTLDLSNNQLQTLPPDLLRGPLNLERLHLEGNRLQVLGEGLLAPQPKLRYLFLNDNRLASVAAGAFRGLQKLDMLDLSNNLLTTVPTGLWTSLGKAARNLKDGFDISNNPWICDQNLADLYRWLVANENKMFFRNHTRCAGPEALKGQTLLAAAESH
>sp|F1N102|F1N102_BOVIN MACPF domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=C8B PE=4 SV=3
MKTSRTWAWRVPVELFLLCAALGSFSVPSSRGERPPSLGSNAVNESLAKTRQTRSVDVTPLPIDCELSSWSSWTTCDPCQKKRYRHAYLIRPSQFHGEQCNFSDKEVEDCVSNRPCRSQVRCEGFVCAQTGRCINRRLLCNGDNDCGDQSDEANCRKTYKKCQQEMEQYWAIGSLASGINLFTNNLEGPVLDHRYYAGLCSPHYILNTRFRKPYNVENFIPQTRGKYDFTLTEYESYSDFEHNVTGTAISRSSFSLGFKIAGIFELGYSSMSNIGQHFISRIRRFSHTKSKFLHARSDLEVAHYKLKTRNLMLHHEFLQRVKQLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLIMNKEAMDRGDYSLKNIHDCAKHDFKIGAAITSVYLKLGVSEAKCSDILNEIKDRNKKDSMVKDLVVLVRGGASEYVTALAYKELPTADLMQEWGDAVQYNPDIIKVKVMPLYELVTATDFAYSSTVKQNMKKALEEFQKEVDSCQCAPCQGNGVPVLKGTRCECICPAGFQGSACEVTHRKNVPIDGKWNCWSNWSPCSGGHKTRQRQCTNPPPGNGGNPCSGPASETLNC
>sp|F1N3V0|F1N3V0_BOVIN Malic enzyme OS=Bos taurus (Bovine) OX=9913 GN=ME1 PE=3 SV=3
MEPRTPRRRHTPQRGYAVTRNPHLNKDLAFTLEERQQLNIHGLLPPSFISQDVQVLRVLKNFERLNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHISSVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQQCLPVMLDVGTENEELLKDPLYIGLRQRRVRGPEYDDFLDEFMEAVSLKYGMNCLIQFEDFANINAFRLLRKYQNQYCTFNDDIQGTASVAVAGILAALRITKNKLSDQTVLFQGAGEAALGIAHLIVMAMEKEGLSKEQAIEKIWLVDSKGLIVKGRAALTQEKEEFAHEHKEMKNLEAIVQDIKPTALIGVAAIGGAFSEQIIKDMAAFNERPIIFALSNPTSKAECTAEQCYKLTKGRAIFASGSPFDPVTLPSGKTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLYPPLDTIRDVSLKIAEKIVKDAYQEKTATVYPEPPNKEAFVRSQMYSTDYDQILPDCYPWPKEAQKIQTKLD
>sp|G3N3S2|G3N3S2_BOVIN Maltase-glucoamylase OS=Bos taurus (Bovine) OX=9913 GN=MGAM PE=4 SV=2
MARKKLKKFTTLELMLSILLLVVFIITIPIFVLSARDSLESQDPGTTVSPDSGTSTTPGSAECPVVNDSERINCIPDQSPTKATCDQRGCCWSPQGTISMPWCYYSKSHGYQVGGDLVNTNAGFTAQLKRLSSPLFGNDVNNVLLTAEYQTSNRFHFKLTDQNQNRYEVPHEHVQPFTGNAASSLTYKVEVSKQPFGIKVIRTSNNRVLFDSSIGPLLFAHQFLQLSIRLPSANVYGLGEHVHQQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLLNSNAMEVFLQPTPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPALPSYWALGFHLSRYDYGTLDNMKEVVERNRAAQLPYDVQHADIDYMDARKDFTYDPVAFKGFPEFVKELHNNGQKLVIIVDPAISNNSSLSNPYGPYDRGSDMKIWVNTSDGVTPLIGEVWPGKTVFPDYTNPKCTAWWTNEFELFHSQVEFDGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPKILDGYLFSKSICMDAVQHWGQHYDVHNLYGYSMAITTAETVKTVFPNKRSLILTRSTFAGSGKFAAHWLGDNAATWSDLRWSIPGMLEFNLFGIPMVGADICGFMLDTSEELCRRWMQLGAFYPFSRNHNGQGYKAQDPASFGPDSLLLNSSRHYLTIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYQDSNTWDVHQQFLWGPGLLITPVLDEGAEKVTAYMPDAVWYDYETGGRVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDENKEAKGELFWDDGETKDTVANNLYLLCEFSVTQNRLEVKILQSTYTDPNNLAFKEIKILGTQEPNKVTVKQNGVPIQVSPNVTYDSNLQVALITEIDLVLGGTYTVEWDVKIRDEEKIDCYPDETGVSAENCTARGCAWEESSSHGVPFCYFVNDLYSVSDVQYDSHGASAVITLKTSLYAHSFPSVPVNSLRLTVTYHKDNMLQFKIYDPSNNRYEVPVPLNIPSIPSGTSESQLYAVLIKKNPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTAFRRDLEWNTWGMFSRDQPPGYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVVLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDAMVAAQIPYDVQYSDIDYMERQLDFTLDAEFEGFPALITRMRADGMRVIIILDPAISGNETKPYLPFTRGVEDDVFIKDPSDGSIVWGKVWPDFPDVVINSSLDWDSQVEKYRAFVAFPDFFRNSTTTWWKRELRELYTNPREPEKSLKFDGLWIDMNEPASFVNGAVPPGCKDATLNHPPYMPYLESRDRGLSSKTLCMESQQVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFARNHNTIGTKRQDPVSWNSTFVTISKSVLETRYTLLPYIYTLMHKASTEGSTVVRPLLHEFVSDRVTWDVDSQFLLGPAFLVSPVLEANARDVTAYFPRARWYDYYTGVDIQSRGEWKSLPAPLDHINLHVRGGYVLPWQEPAQNTHLSRKNSLGLIIALDSKREAKGELYWDDGVSKDAVTGNNYILYKFSITSNRLQATIIHANYTDPDKLTFTDIMILGMDKEPTNFTVSLNDVTTSISNVVYTESTKVVNITDLEGLVLGQAFSIQWDLPVSDLQKFNCFPEQPAVSEESCRERGCLWEVRTRTMVPAPSSQDKLSPPAAAAKAASASDTLSATIGFLRLSVTYHTENMLQFKIYDPTNKRYEVPVPLNTPSSPVGSPENCLYDVKIQNNPFGIQIRRKSSSTVIWDSQLPGFTFRDMFLSISTRLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMIPYWALGFQLSRYGYQDDYEISSLYVAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGPLIEQMKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKWPDNSDIVWGKVWPDLPNVNVDGSLDHETQVKLYKAHVAFPDFLRNSTAAWWKREIEELYRNPREPEKSLKFDGLWINMNEPSNFVNGSVRGCSDEILNNPPYVPYLESRDRGLSSRTLCMESQQVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNRAAWDQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWDSAFEMFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEERTTWDIDHQFMLGPAVLISPVLENNTFQVQAYFPRARWYDYSTGSGNESTGEWKVLEAPLDHINLHIRGGYILPWQEPAMNTYSSRQKYMGLIVALDDNGRAEGQLFWDDGQSIGECIMYLFLFIHSLQSVLQIQMIHNNYLSDTNSLKVGYIRIWGINSTDITQVTVSYDNQQFMVMNFKSDPYNQVCLKRMLSYHTVILFFCKVISTIVIFTYT
>sp|O02659|O02659_BOVIN Mannose-binding protein C OS=Bos taurus (Bovine) OX=9913 GN=MBL PE=2 SV=1
MSLFTSLPFLLLTAVTASCADTETENCENIRKTCPVIACGPPGINGIPGKDGRDGAKGEKGEPGQGLRGSQGPPGKMGPQGTPGIPGIPGPIGQKGDPGENMGDYIRLATSERATLQSELNQIKNWLIFSLGKRVGKKAFFTNGKKMPFNEVKTLCAQFQGRVATPMNAEENRALKDLVTEEAFLGITDQETEGKFVDLTGKGVTYQNWNDGEPNNASPGEHCVTLLSDGTWNDIACSASFLTVCEFSL
>sp|Q2HJ49|Q2HJ49_BOVIN Moesin OS=Bos taurus (Bovine) OX=9913 GN=MSN PE=2 SV=3
MPKTINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREIWFFGLQYQDTKGFFTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEDILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDRLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERALLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASQDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASAELRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
>sp|A6QNL0|A6QNL0_BOVIN Monocyte differentiation antigen CD14 OS=Bos taurus (Bovine) OX=9913 GN=CD14 PE=2 SV=1
MVRVCVPYLLLLLLPSLLRVSADTTEPCELDDDDFRCVCNFTDPKPDWSSAVQCMVAVEVEISAGGRSLEQFLKGADTNPKQYADTIKALRVRRLKLGAAQVPAQLLVAVLRALGYSRLKELTLEDLEVTGPTPPTPLEAAGPALTTLSLRNVSWTTGGAWLGELQQWLKPGLRVLNIAQAHSLAFPCAGLSTFEALTTLDLSDNPSLGDSGLMAALCPNKFPALQYLALRNAGMETPSGVCAALAAARVQPQSLDLSHNSLRVTAPGATRCVWPSALRSLNLSFAGLEQVPKGLPPKLSVLDLSCNKLSREPRRDELPEVNDLTLDGNPFLDPGALQHQNDPMISGVVPACARSALTMGVSGALALLQGARGFA
>sp|A0A3Q1N1J8|A0A3Q1N1J8_BOVIN Neural cell adhesion molecule 1 OS=Bos taurus (Bovine) OX=9913 GN=NCAM1 PE=4 SV=1
MPPEETPVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTAEDGTESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLTNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCNAEGFPEPTVSWTKDGEQIENEEDEKYLFSDDSSELTIRKVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYVCTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAMGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQMGEDGNSIKVKLIKQDDGGSPIRHYLVKYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILVVTFVLLLVAVDVTCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPELPADTTATVEDMLPSVTTVTANSDTITETFATAQNSPTSETTTLTSSIAPPVAATPDSNSVPAGQATPSKGTGVTAASPAPAPAPKVAPLVDLSDPPASAPAANNLSSSVLANQGAVLSPSTPASAGEAPKTPPASKAVSPSAASPLAAAPTAPAPEAPQAKQEAPGTKGPDPEPTQPGASKSPPEAARALASPKSEAASVSTTNPAQGEDFKMDEGNFKTPDIDLAKDVFAALGSPAPAAGASGQASELAPSTADGSLPPAPVKTEKGPVEAKPETETKPAPAEVQTVPNDATQIKENESKA
>sp|Q2KIW1|Q2KIW1_BOVIN Paraoxonase 1 OS=Bos taurus (Bovine) OX=9913 GN=PON1 PE=1 SV=1
MAKLLVLTLLGLGLAFFRDYRSSYLARMNASREVKSVELPNCKLIKGIETGAEDLEILPNGLAFISSGLRYPGVKSFEPDKPGKILLMDLNKEDPTVLELKMTGSNFDASSFNPHGISTFTDEDNTVYLLVVSHPDVKSTVELFKFQEEEKSLLHLKTIKHELLPNLNDLVAVGREHFYATNDHYFVDQYMRSWELYLGLAWSNVVYYSPDDVRVVASGFDFANGISMSPDRKYVYIAELLAHKIHVYEKHANWTLTPLKSLDCDTLVDNISVDPVTGDLWVGCHPNGMKIFSYDPENPPGSEVLQIQNILAEEPKVTVVYAEDGKVLHGSTVASVYKGKMLVGTVFQKALYCEF
>sp|A5PJB8|A5PJB8_BOVIN Peptidase S1 domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=CTRB1 PE=2 SV=1
MALLWVVLGFFLFGSSFGCGVPAIDPVLSGLSRIVNGEDAVPGSWPWQVSLQTSSGFHFCGGSLISEDWVVTAAHCGVRKGHLVVAGVSDQGSEEEAGQVLRVAEVFEHPQWDLRAVRNDVALLKLAAPARLSAAVAPVCLPSADTSFPTGSLCTVTGWGKTRYNAFDTPDKLQQATLPILSNADCREFWGSKITDVMICAGASGISSCMGDSGGPLVCQKDGAWTLAGIVSWGSSRCSPFLPGVYARVTKFIPWILEVLEAN
>sp|P62935|P62935_BOVIN Peptidyl-prolyl cis-trans isomerase A OS=Bos taurus (Bovine) OX=9913 GN=PPIA PE=1 SV=2
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI
>sp|D1Z308|D1Z308_BOVIN Periostin OS=Bos taurus (Bovine) OX=9913 GN=POSTN PE=1 SV=2
MIPFLPVCSLFLLLVVNPANANGHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYLSTCRNWYQGAICGKKTTVLYECCPGYMRMEGMKGCPAVMPIDHVYGTLGIVGATTTQSYSDVSKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMVNKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDELSSFRAAAITSDILETLGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSEAIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLVPDSAKQVIELAGNQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMDQRLLKLILQNHILKVKIGLNELYNGQKLETIGGKQLRVFVYRTAVCIENSCMVRGSKQGRNGAIHIFQEIIKPAEKSLHEKLKQDKRFSIFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTNEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIYLKGVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPITVYTTKIITKVVEPKIKVIEGSLQPIIKTEGRTIPKVKIEGEPEFRLIKEGETVTEVIHGEPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTTGGETEETLKKLLQEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKIQANKRVQASRRRSREDRPQ
>sp|Q58DL9|Q58DL9_BOVIN Phospholipid transfer protein OS=Bos taurus (Bovine) OX=9913 GN=PLTP PE=2 SV=1
MTPAIPTPSPGPLAMALFGALILALLAGAHAELPGCKIRITSKALELVKQEGLRFLEQELETVTIPDLRGSEGHFFYNISEVKVTELQLTFSELHFQPDQELVLQINNASWGLRFRRQLLYWFFYDGGYINASAEGVSIHTALQLSRDTIGRIKVSNVSCQASVSRMHAAFGGTLKKVYEFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSAVDELVGIDYSLLKDPVASTSNLDMEFRGAFYPLTEANWSLSNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALKLSLVGDKVPHDLDMVLRASYFGSIVLMSPAVIDSPLKLELRVMEPPRCTIKPSGTTVSVTASVTIALVPPNQPEVQLSSMIMDARLSAKMALRGKALRTQLDLRRFRIYSNQSALESLALIPLQTPLKTLLQIAVMPMLNERTWRGVQIPLPEGIDFVREVVTNHAGFLTIGADLHFAKGLREVIEKNRPADTRDPRTSSAPPPSTAAV
>sp|Q2HJB6|Q2HJB6_BOVIN Procollagen C-endopeptidase enhancer OS=Bos taurus (Bovine) OX=9913 GN=PCOLCE PE=2 SV=1
MLPAATASLLGPLLTAWALLLPFTHGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPNKECIWTITVPKSQTVSLSFRVFDLEQHPSCRYDALEIFAGSGTSGQQLGRFCGTFRPAPVVASGNQVTLRMRSDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVISLTFGKFDLEPDSYCRYDSVSVFNGPVSDDAKRLGKFCGDTVPGSITSEGNELLVQFVSDLSVTADGFSASYRTQPRGATEGVPGEVGLGPKPGAGPKVKPEVPPEEKSKAAPKAEATPVGPDAPSVTCPKQCRRTGTLQSHFCNSDLVVTGMIKSMVRGPGEGLTATVNVTGVYKTGGLDLPSPPTDTLLKFYVPCKQCPPMKKGISYLLMGQVDKNRGPILPPESFVVLHRPTQHQILTNLSRKCPSKPV
>sp|E1BHJ0|E1BHJ0_BOVIN Profilin OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000018312 PE=3 SV=2
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSIWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMDSHLRRSQY
>sp|P01190|P01190_BOVIN Pro-opiomelanocortin OS=Bos taurus (Bovine) OX=9913 GN=POMC PE=1 SV=1
MPRLCSSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLACIRACKPDLSAETPVFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNGSSSSGVGGAAQKREEEVAVGEGPGPRGDDAETGPREDKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLEFKRELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
>sp|P00978|P00978_BOVIN Protein AMBP OS=Bos taurus (Bovine) OX=9913 GN=AMBP PE=1 SV=2
MRSLSGLLLLLTACLAVNASSVPTLPDDIQVQENFDLSRIYGKWFNVAVGSTCPWLKRFKEKMTMSTVVLIAGPTSKEISVTNTHRRKGVCESISGTYEKTSADGKFLYHKAKWNITMESYVVHTNYDEYAIFLTKKLSRRHGPTITVKLYGREPQLRESLLEEFREVALGVGIPEDAIFTMPDRGECVPGEQDPVPTPLSRARRAVLTQEEEGSGAGQPVTNFSKKADSCQLDYSQGPCLGLFKRYFYNGTSMACETFLYGGCMGNGNNFLSEKECLQTCRTVEACNLPIVQGPCRSYIQLWAFDAVKGKCVRFSYGGCKGNGNKFYSEKECKEYCGIPGEADEELLRFSN
>sp|A0A3Q1LZ67|A0A3Q1LZ67_BOVIN Proteoglycan 4 OS=Bos taurus (Bovine) OX=9913 GN=PRG4 PE=4 SV=1
MEWKILPIYLLLFSVFLIQQASSQDLSSCAGRCGEGYSRDAICNCDYNCQHYTECCPDFKKECTVELSCKGRCFETFARGRECDCDSDCKKYGKCCSDYGTFCEAVKDKKKRTPKNKPTPEPPVIDEDGSGLDNGDFKLTPTPNIPTTQRNKVTTTPKITTVKPTLPKPSLPPNSDTTKEIPSTVNRETTVETKETSTTNKPTSTSAKEKTTSAKETRTAENTSTKGLAPTPEVPAISTPKAETITRSPTPTTPKEPAPTTKEPALTTTTKEPASTTPKKPAPTTPKETAPTTKEPEPTTKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPEPTTPKQPAPTTPKQPAPTTSKETAPTTKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTKEPEPTTPKQPAPTTPKEPAPTTPKETAPTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTKEPESTTKEPEPTTKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPAPTTPKQPAPTTPKEPAPTTPKEPAPTTKEPAPTTKEPEPTTKEPAPTTTPKEPAPTTPKEPAPTTKEPEPTTLKQPAPTTPKEPAPTTPKEPAPTTPKEPTPTTPKEPAPTTPKEPAPTTPKEPTPTTPKEPAPTTTPKEPAPTTKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAPTSPKEPAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTPKALENSPKEPAVPTIKGPKVNKPEITTTVKDKSTEKDIYSTPEITTAVAKIITEAATKTEKTTESKIPSTTTDVTSTTTKDTTSSKITPKATLAPKVMTATKKTTEKTKNKPEKTTAVPKGRATNSQVTTPKPQKPTKAPKKPTSTKKPRTPRVRKPKTTPTPPKTTTSAMPEPTPTSLPEAMLQTTTRPTPTPNSEIIDVNPENEDGDAAEGEKPHMIFRPPVLTPIVIPGTEIIVRGPSQGFGINPMFSDETNLCNGRPVDGLTTLRNGTLVAFRGHYFWMLTPFTPPPPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKGSQYWRFTNDIKDAGYPKLISKGFGGLNGKIVAALSIAQYKSRPESVYFFKRGGSVQQYTYKQEPTQKCTGRRPAINYSVYGETAQVRRRRFERAIGPSQVHTIRIHYTPVRVPYQDKGFLHNEVKVSTLWRGLPNVVTSAISLPNIRKPDGYDYYALSKDQYYNIDVPSRTARAITTRSGQTLSNTWYNCP
>sp|A0A452DI66|A0A452DI66_BOVIN Prothrombin OS=Bos taurus (Bovine) OX=9913 GN=F2 PE=3 SV=1
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERECLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGNVSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRREECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTRGSRCLAWSSEQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDLGDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
>sp|A5D984|A5D984_BOVIN Pyruvate kinase OS=Bos taurus (Bovine) OX=9913 GN=PKM PE=1 SV=1
MSKHHSDAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRAVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKIYVDDGLISLLVKQKGPDFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQNVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLSPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
>sp|P21856|P21856_BOVIN Rab GDP dissociation inhibitor alpha OS=Bos taurus (Bovine) OX=9913 GN=GDI1 PE=1 SV=1
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPETMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDIYKRMAGSAFDFENMKRKQNDVFGEADQ
>sp|P82943|P82943_BOVIN Regakine-1 OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000010155 PE=1 SV=2
MRVSLAALAFLLTLAVLHSEANEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEAVIFQTRSGRSICANPGQAWVQKYIEYLDQMSK
>sp|A0A3Q1MUJ8|A0A3Q1MUJ8_BOVIN Sema domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=PLXNB2 PE=4 SV=1
MGRGAWTRIRRRPGGPAPRGGSGSGRSSAPAGRPAPAPARPLAPSLGSGNIPFIPRPALAGAAAGAKAELGRGRGGGNAGTRGAGAMALQLWALALLGLAGTSASLRPRKLDSFRSETELNHLVVDEASGMVYVGAVNMLYQLSADLQLEQRVATGPALDNKKCTPPIEVSQCHEAVQTDNVNQLLLLDPPRSRLVECGSLFKGICALRALGNISTRLFYEDGSGEKSFVASNDESVATVGLVSAADPGGERLLFVGKGNGPHDNGVIVSTRLLDRTEGREAFEAYTDHATYKAGYMSSNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCKQDPFYYSYLEVDLSCLDPGDAQAPAFGTCLAASLDRPGSGGVLYAVFSTDGRGGRGPRTGLCLFPLDEVHRRMEANRDACYTGAREVARDTFYKPFHGDIQCGGHVSVRGLSVLTGAWATCGGVCAWPCLTCVHMPPCCEGCVRLHGCVGFPRAGQRGHPHGCLFSQVLGAPGVGAWSSEHPGALVWPGWFWGMCAAECWGPSRERGLGQALTPWSAGCQQEFPVWLGALALPAGQPRRPLGQSRAAPWRPEPDGRDRDHRERPHHRLSGHLGWPGPQGEAQGWGRVAPGGVLSAQDGPALTARLPPCPQVYFAPDGSSTEYGAILVEINKRIKRDLVLAADLASLYAMTQDKVFRLLVQECASFSSCAHCQSSQDPYCGWCVVEGRCTRKAECPRADESGHWLWSRNESCVAVTGAHPQNMSRQAQGEVQLTVSPLPALRDDDTLLCLFGGSPPHPARLQEGAVVCNSPSRSSLPRTPPGQDHVAVTIRLHFKRGNVFLTSHQYPFYDCREAMSLQENLPCISCSSNRWTCQWALLEHACQQASPGPEDGVVGAHMEDDCPQFLNPSPLVIPVNHETDVTFQGKNLDTVQGSPLLVGSDLLKFEALVSTQEPGTFSFRTPKLTHDANETLPLHLYVKSAGKNVDSRLQVTLYNCSFGRSDCSLCLAADPAYRCVWCSGRSRCVYEALCSNATSECPPPVVTRIQPETGPLGGGIRVTILGSNLGVRADDVKRVTVAGQNCAFEPERYSVSTRIVCTIEAAEEPCTGGVEVDINGKLGHSPPHAQFTYQQPQPHSVEPKQGPQAGGTTLTINGTHLDTGSEEDVRVTLSDVPCNVTQFGAQLQCVTGPQAVPGELALKIYYGGSEVPNPGITFTYRENPVLRAFEPLRSFVSGGRSINVTGQGFSLIQRFAMVVIAEPLQSWRRRRETGPLRSVTVVGTEYVFYNDSKVVFLSPAVPEEPEAYNLTALIRMDGHQALLRTEAGAFEYVADPTFENFTGGVKKQVNKLIHARGTNLNKAMTIHEAEAFVGAERCIMKTLTETDLYCEPPEVQPPPKRRQKRDTAHNLPEFIVKFGSREWVLGRVEYDTRASDVPLSLILPLVIGPMVAVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPESRRQVVEQALYQFSNLLNSKCFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYTPLTVSVIVQDEGVDAVPVKVLNCDTISQVKEKIIDQVYRTQPCSRWPKADSVVLEWRPGSTAQILSDLDLTSQREGRWRRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGNAVPPAVKYFFDFLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
>sp|A0A0A0MP92|A0A0A0MP92_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-7 PE=1 SV=1
MRTERTSFLLALGLLVSGFCSRVHCLPENVTPEEQHKGTSVDGHSLASSNTDFAFSLYKQLALKDPNKNVIFSPLSISIALAFLSLGAHDHTVTEILEGLKFNLTETPETEIHQGFQHLLQTFNQPSNQLQLSVGNAMFVSEELKLLDKFRKDAEAFYASEVLSTNFKDSEAAVKLINEYVKNKTHGKIEKLFNDLDVLTNLILLNYIFFKAQWKTPFNPNHTYESEFHVSQNERVIVPMMTLYLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMQDLEAKLTPETLTRWRNSLQPRLIHRLRLPRFSISSHYQLKDILSQLGIKKIFTSDADFSGITDDHKLAVSHVIHKAVLDVGEEGTEGAAVTAVVMATSSLLHTLTVSFNRPFLLSIFCKETQSIIFLGKVTNPKEA
>sp|A0A452DJK6|A0A452DJK6_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPINA3-1 PE=3 SV=1
MVIYPFQSEDRVLCCPRQCFTSLGGGLCRINRQQHPGNSSIRAGGGSGSTAHIPLSQADMRAERTSFLLALGLLVAGIRSVHCLPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGISMERTILRIIVRVNRPFLIAIVLKDTQSIIFLGKVTNPSEA
>sp|A0A0A0MPA0|A0A0A0MPA0_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=LOC784932 PE=1 SV=1
MRTERMSPLLALGLLVSGLCSRVHCLPENVTPEEQHKVTSVDGHSLASSNTDFAFSLYKQLALKDPNKNVIFSPLSISIALAFLSLGAHGPTVTEILEGLKFNLTETPETEIHQGFQHLLQTFNQPSNQLQLSVGNAIFVPEELKLLDKFRKDAEAFYASEVLSINFKDSEAAVKLINEYVKNKTHGKIEKLLNDLDVLTNLILLNYIFFKAQWKTPFNPNHTYESEFHVSKNERVKVPMMTLRLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMQDLEAKLTPETLTRWRNSLQPRHIDELSLPRFSISSDYQLRDILSQLGIKKIFTSDADFSGITNDHKLAVSQVIHKAVLDVGEEGTEGAAVTAVIMFTSLPLHALNISFNRPFLLSIFCKETQSIIFLGKVTNPKEA
>sp|A0A3Q1NJR8|A0A3Q1NJR8_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPINC1 PE=3 SV=1
MISNGIGTVTAGKRSICLLPLLLIGLWGCVTCHRSPVEDVCTAKPRDIPVNPMCIYRSSEKKATEGQGSEQKIPGATNRRVWELSKANSHFATAFYQHLADSKNNNDNIFLSPLSISTAFAMTKLGACDNTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSELVSANRLFGDKSITFNETYQDISEVVYGAKLQPLDFKGNAEQSRLTINQWISNKTEGRITDVIPPQAINEFTVLVLVNTIYFKEVGQASLSAWQDSQMTPWGYYLCLALFIREKAQHFGGWSLRRRLVGGRRQKAIRFKLQKRLAKRPGLWKSKFSPENTRKELFYKADGESCSVLMMYQESKFRYRRVAESTQVLELPFKGDDITMVLILPKLEKTLAKVEQELTPDMLQEWLDELTETLLVVHMPRFRIEDSFSVKEQLQDMGLEDLFSPEKSRLPGIVAEGRSDLYVSDAFHKAFLEVNEEGSEAAASTVISIAGRSLNSDRVTFKANRPFLVLIREVALNTIIFMGRVANPCVD
>sp|A0A3Q1LGY9|A0A3Q1LGY9_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=AGT PE=1 SV=1
MAPAGLSLGAAILCLLAWAGLAAGDRVYVHPFHLLVYSKSNCDQLEKPSVETPPDPTFTPVPIQTKSSAVDEEALWEQLVRATEKLEAEDRLRASEVGLLLNFMGFHMYKTLSETWSVASGAVFSPVALFSTLTSFYVGALDPTASRLQAFLGVPGEGQGCTSRLDGHKVLSSLQTIQGLLVAQGGASSQARLLLSTVVGLFTAPGLHLKQPFVQSLSSFAPITLPRSLDLSTDPNLAAEKINRFMQSVTGWNMGRALTAVSPDSTLLFNAYVHFQGKMKGFSLLPGLKEFWVDNTTSVSVPMLSGTGIFHFWSDSQNNLSVTRVPLSANTYLLLIQPHHTPDLRKVEALTFQHNFLTRMKNLSPRAIHLTMPQLTLKASYDLQDLLAQAKLPTLLGAEANLSKISDANLRVGKVLNSVLFELKADGEQAPESVPQPAGPEALEVTLNSPFLLAVLERSSGALHFLGRVSRPLSAE
>sp|F6R4P6|F6R4P6_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPIND1 PE=3 SV=1
MWSRSCWAVTRHTAGLCADEAGGRCSICDLCTLEDLDCSPAPKVTEERGRPWPIPPLQSHFAPAAQSSSGMWCPLRPLLLALLLASACRTLGPWGQRDDGGGEPESMEPRWGRLKGSNASGPLPPAAFHEENTVTGEWAADGEEEEDYLDLEKIFGEDDNYSDVVDAAPPTRPGAGAGSVLPLFPGKSRVQRLNLLNAQFAFDLYRALAARVGAADNVFLAPVGVSAAMAMLSLGLAGDTHQEVHTALRFAEFVNASAAYELGTVHNLFRKLIHRLFRRNFGYTLRSVSDLYVQKQLPVLDDFKTQVREYYFAEVRAADFSDPAFLAHTNRHVARLTKGLIRDALQDVDPATQMLLLNCLYFKGSWVNKFPVEMTHNHNFRLNEREVVKVPMMQTKGAFLAASDQELDCDVLRLEYVGGISMLVVVPHKLSGMKTLESQLTPQAVERWQRSMTNRTREVLLPKFKLEKDYDLVGALRALGVTALFDKHSNTTGITGQRIVIDLFKHQGTITVNEEGTQAAAVTAVGFMPLSTQVRFSVDRPFLFLIYEHRTSCLLFLGRVANPTRP
>sp|A6QPW6|A6QPW6_BOVIN SERPIN domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=SERPINI2 PE=2 SV=1
MDKILLWSLLLTFSGSQASSPWAQRNAEFVVDLYQAVGLSHKNNIIISPLGTTLALGMVQLGAKGKAQQQIRKTLKFQDTSTGEEFSELKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQNAKACAETISNWVESKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFNKEDTQLMNFTLKDGTAVKIPMMKALLRTKYGYFSESSINYQVLELPYKGDEFSLIIILPAEHTNIEEMEKLITAPQILQWFSEMQEQEVEISLPRFKVEQKLDFKEALYSLNITEIFSGGCDLSGITDSSEVYVSRVMQQVFFEINEEGSEVATSTGINTPVIMSLSRNQFIANHPFLFIMKNNPTDSILLMGRVTNPDTQRMKGRDLDSL
>sp|A0A140T897|A0A140T897_BOVIN Serum albumin OS=Bos taurus (Bovine) OX=9913 GN=ALB PE=4 SV=1
MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA
>sp|Q3T004|Q3T004_BOVIN Serum amyloid P-component OS=Bos taurus (Bovine) OX=9913 GN=APCS PE=2 SV=1
MNKLMSWVSVLIILPEAFAQTDLRGKVFVFPRESSTDHVTLITKLEKPLKNLTLCLRAYSDLSRGYSLFSYNIHSKDNELLVFKNGIGEYSLYIGKTKVTVRATEKFPSPVHICTSWESSTGIAEFWINGKPLVKRGLKQGYAVGAHPKIVLGQEQDSYGGGFDKNQSFMGEIGDLYMWDSVLSPEEILLVYQGSSSISPTILDWQALKYEIKGYVIVKPMVWG
>sp|A0A3Q1LZG1|A0A3Q1LZG1_BOVIN Somatotropin OS=Bos taurus (Bovine) OX=9913 GN=GH1 PE=3 SV=1
MFSVPGGKGPRTSLLLAFALLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMREVEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
>sp|A0A3Q1MLQ7|A0A3Q1MLQ7_BOVIN Talin 1 OS=Bos taurus (Bovine) OX=9913 GN=TLN1 PE=1 SV=1
PGWREEAAAMVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALSGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLMTICARIGITNHDEYSLVREIMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDAQLLRGVGAAATAVTQALNELLQHVRAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAANPDSEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHATSTPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLERDLQEVKAAARDGKLKPLPGETMEKCAQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPAAPTLKSQLAAAARAVTDSINQLISMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAVATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAYHPEVAPDVRLRALHFGRECANGYLELLDHVLLTLQKPSPELKQQLTVHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRDEH
>sp|F1MW44|F1MW44_BOVIN TGc domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=F13A1 PE=4 SV=2
MSESSWTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTNVHLFKERWDSNKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPTRDLFRVEYVIGLYPQENKGTYIPVPLVSELQSGKWGAKVVMREDRSVRLSVQSSADCIVGKFRMYVAVWTPYGVIRTSRNPETDTYILFNPWCEEDAVYLENEKEREECVLNDIGVIFYGDFNDIKSRSWSYGQFEDSILDACLFVMDKANMDLSGRGNPIKVSRVGSAMINAKDDEGVIAGSWDNVYAYGVPPSAWTGSVDILLEYKSSQKPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQLDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKHGHVCFQFDAPFVFAEVNSDLVYVTAKKDGTHVVEALDTTHIGKLIVTKEIGGDGMKDITDTYKFQEGQEEERLALETAMMYGAKKALNTEGVLKSKSDVRMNFEVENAVLGRDLKVIITFRNNGSARYTVTAYLSGNISFYTGVSKAEFKNKTFEVTLEPLSFKREEVLIGAGEYMGQLLEQAFLHFFVTARVNETRDVLAKQKSIALTVPKVVIKVRGAQVVGSDMVVTVEFTNPLKETLRNVWIRLDGPGVTKPLRKMFREIRPNSTVQWEELCRPWVSGPRKLIASLTSDSLRHVYGELDLQIQRRPSM
>sp|A0A3Q1MQV3|A0A3Q1MQV3_BOVIN Thrombospondin-1 OS=Bos taurus (Bovine) OX=9913 GN=THBS1 PE=4 SV=1
MGLAWGLGVLLLLHACGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDKKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAVERKDHSGQVFSVISNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSIFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVFVTLDNNVVNGSSPAIRTDYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRTGDEWTVDSCTECRCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGKARETKACQKDSCPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCIGDVTENQICNKQDCPIDGCLSNPCFAGVQCTSYPDGSWKCGACPPGYSGDGVECKDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLLCVANATYHCRKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQKDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDQDKVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTSGQVRTLWHDPRHIGWKDFTAYRWHLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDDSASVN
>sp|A0A452DJ62|A0A452DJ62_BOVIN Thrombospondin-4 OS=Bos taurus (Bovine) OX=9913 GN=THBS4 PE=4 SV=1
MLAPRGATFLLLHLALQPWLGAGAQATPQVFDLLPSASQRLNPSVLQPILTDPTLNELYVISTFKLQSKSSATIFGLYSSADHSKYFEFTVMGRLNKAILRYLKNDGRIHLVVFNNLQLADGRRHRLLLRLTNLHRGAGSVELFLDCTRVDSIHNLPRAFSGLAQSPEAVELRTFQRKAHDSLEELKLVVRGSLIQVASLQDCFLQQSEPLATTNTGDFNRQFLGQMSQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLMPVVPAASPTPPVRRCDSNPCFRGVRCTDTRDGFQCGPCPEGYTGNGIVCSDVDECKYHPCYPGVRCVNLAPGFRCDACPVGFTGPMMQGVGISFAKTNKQVCTDIDECRNGACVLNSICINTLGSYRCGPCKPGYIGDQMRGCKMERNCRDPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDDDADGDGILNEQDNCVLTHNVDQRNSDKDIFGDACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCQKVPNSDQEDRDGDGVGDACDSCPEVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICEADFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDK
>sp|A0A3Q1M6P2|A0A3Q1M6P2_BOVIN Thyroglobulin OS=Bos taurus (Bovine) OX=9913 GN=TG PE=4 SV=1
MALALWVFGLLDLICLASANIFEYQVDAQPLRPCELQRERAFLKREDYVPQCAEDGSFQTVQCGKDGASCWCVDADGREVPGSRQPGRPAACLSFCQLQKQQILLSSYINSTATSYLPQCQDSGDYSPVQCDLRRRQCWCVDAEGMEVYGTRQQGRPARCPRSCEIRNRRLLHGVGDRSPPQCSPDGAFRPVQCKFVNTTDMMIFDLVHSYSRFPDAFVTFSSFRSRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDLASTFAETTLYRILQRRFLAVQLVISGRFRCPTKCEVERFAATSFRHPYVPSCHPDGEYQAAQCQQGGPCWCVDSRGQEIPGTRQRGEPPSCAEDQSCPSERRRAFSRLRFGPSGYFSRRSLLLAPEEGPVSQRFARFTASCPPSIKELFLDSGIFQPMLQGRDTRFVAPESLLKEAIRGLFPSRELARLALQFTTNAKRLQQNLFGGRFLVNVGQFNLSGALGTRGTFNFSHFFQQLGLPGFQDGRALADLAKPLSVGLNSNPASEAPKASKIDVALRKPVVGSFGFEVNLQENQNALQFLSSFLELPEFLLFLQHAISVPEDIARDLGDVMEMVFSSQGCGQAPGSLFVPACTAEGSYEEVQCFAGDCWCVDAQGRELAGSRVRGGRPRCPTECEKQRARMQSLLGSQPAGSSLFVPACTSKGNFLPVQCFNSECYCVDTEGQPIPGTRSALGEPKKCPSPCQLQAERAFLGTVRTLVSNPSTLPALSSIYIPQCSASGQWSPVQCDGPPEQAFEWYERWEAQNSAGQALTPAELLMKIMSYREAASRNFRLFIQNLYEAGQQGIFPGLARYSSFQDVPVSVLEGNQTQPGGNVFLEPYLFWQILNGQLDRYPGPYSDFSAPLAHFDLRSCWCVDEAGQKLEGTRNEPNKVPACPGSCEEVKLRVLQFIREAEEIVTYSNSSRFPLGESFLAAKGIRLTDEELAFPPLSPSRETFLEKFLSGSDYAIRLAAQSTFDFYQRRLVTLAESPRAPSPVWSSAYLPQCDAFGGWEPVQCHAATGHCWCVDGKGEYVPTSLTARSRQIPQCPTSCERLRASGLLSSWKQAGVQAEPSPKDLFIPTCLETGEFARLQASEAGTWCVDPASGEGVPPGTNSSAQCPSLCEVLQSGVPSRRTSPGYSPACRAEDGGFSPVQCDPAQGSCWCVLGSGEEVPGTRVAGSQPACESPQCPLPFSVADVAGGAILCERASGLGAAAGQRCQLRCSQGYRSAFPPEPLLCSVQRRRWESRPPQPRACQRPQFWQTLQTQAQFQLLLPLGKVCSADYSGLLLAFQVFLLDELTARGFCQIQVKTAGTPVSIPVCDDSSVKVECLSRERLGVNITWKLQLVDAPPASLPDLQDVEEALAGKYLAGRFADLIQSGTFQLHLDSKTFSADTSIHFLQGDRFGTSPRTQFGCLEGFGRVVAASDASQDALGCVKCPEGSYFQDEQCIPCPAGFYQEQAGSLACVPCPEGRTTVYAGAFSQTHCVTDCQKNEVGLQCDQDGQYRASQRDRTSGKAFCVDGEGRRLPWTEAEAPLVDAQCLVMRKFEKLPESKVIFSADVAVMVRSEVPGSESSLMQCLADCALDEACGFLTVSTAGSEVSCDFYAWASDSIACTTSGRSEDALGTSQATSFGSLQCQVKVRSREGDPLAVYLKKGQEFTITGQKRFEQTGFQSALSGMYSPVTFSASGASLAEVHLFCLLACDHDSCCDGFILVQVQGGPLLCGLLSSPDVLLCHVRDWRDPAEAQANASCPGVTYDQDSRQVTLRLGGQEIRGLTPLEGTQDTLTSFQQVYLWKDSDMGSRSESMGCRRDTEPRPASPSETDLTTGLFSPVDLIQVIVDGNVSLPSQQHWLFKHLFSLQQANLWCLSRCAGEPSFCQLAEVTDSEPLYFTCTLYPEAQVCDDILESSPKGCRLILPRRPSALYRKKVVLQDRVKNFYNRLPFQKLTGISIRNKVPMSDKSISSGFFECERLCDMDPCCTGFGFLNVSQLKGGEVTCLTLNSLGLQTCSEEYGGVWRILDCGSPDTEVRTYPFGWYQKPVSPSDAPSFCPSVALPALTENVALDSWQSLALSSVIVDPSIRNFDVAHISTAAVGNFSAARDRCLWECSRHQDCLVTTLQTQPGAVRCMFYADTQSCTHSLQAQNCRLLLHEEATYIYRKPNIPLPGFGTSSPSVPIATHGQLLGRSQAIQVGTSWKPVDQFLGVPYAAPPLGEKRFRAPEHLNWTGSWEATKPRARCWQPGIRTPTPPGVSEDCLYLNVFVPQNMAPNASVLVFFHNAAEGKGSGDRPAVDGSFLAAVGNLIVVTASYRTGIFGFLSSGSSELSGNWGLLDQVVALTWVQTHIQAFGGDPRRVTLAADRGGADIASIHLVTTRAANSRLFRRAVLMGGSALSPAAVIRPERARQQAAALAKEVGCPSSSVQEMVSCLRQEPARILNDAQTKLLAVSGPFHYWGPVVDGQYLRETPARVLQRAPRVKVDLLIGSSQDDGLINRAKAVKQFEESQGRTSSKTAFYQALQNSLGGEAADAGVQAAATWYYSLEHDSDDYASFSRALEQATRDYFIICPVIDMASHWARTVRGNVFMYHAPESYSHSSLELLTDVLYAFGLPFYPAYEGQFTLEEKSLSLKIMQYFSNFIRSGNPNYPHEFSRRAPEFAAPWPDFVPRDGAESYKELSVLLPNRQGLKKADCSFWSKYIQSLKASADETKDGPSADSEEEDQPAGSGLTEDLLGLPELASKTYSK
>sp|P55906|P55906_BOVIN Transforming growth factor-beta-induced protein ig-h3 OS=Bos taurus (Bovine) OX=9913 GN=TGFBI PE=1 SV=2
MALLGRLLPLALALALGPAATPAGPARSPYQLVLQHSRLRGRQHGPNVCAVQKLIGTNKKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGATTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWSSLPAEVLDSLVSNVNIELLNALRYHMVDRRVLTDELKHGMALTSMYQNSNIQIHHYPNGIVTVNCARLLKADHHATNGVVHLIDKVISTVTNNIQQIIEIEDTFETLRAAVAASGLNTLLEGDGQYTLLAPTNEAFEKIPAETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSLETLEGTTLEVGCSGDMLTINGKPIISNKDVLATNGVIHFIDELLIPDSAKTLFELAADSDVSTAIDLFRQAGLSSHLSGNERLTLLAPMNSVFKDGTPPINARTKNLLLNHMIKDQLASKYLYHGQTLDTLGGRKLRVFVYRNSLCIENSCIAAHDKRGRYGTLFTMDRMLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFQALPRGELNKLMGNAKELANILKYHVGDEILVSGGIGALVRLKSLQGDKLEVSSKNNVVSVNKEPVAEVDIMATNGVVHAISSVLQPPANRPQERGDELADSALEIFKQASAFSRATQSSVKLAPVYQRLLERMKH
>sp|Q5E9F5|Q5E9F5_BOVIN Transgelin-2 OS=Bos taurus (Bovine) OX=9913 GN=TAGLN2 PE=2 SV=3
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINGLYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRYFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL
>sp|A0A3Q1M3L6|A0A3Q1M3L6_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000055240 PE=1 SV=1
MPEPVTVTWNSGALKSGVHTFPAVLQSSGLYSLSSMVTVPASSSGQTFTCNVAHPASSTKVDKAVDPTCKPSPCDCCPPPELPGGPSVFIFPPKPKDTLTISGTPEVTCVVVDVGHDDPEVKFSWFVDDVEVNTATTKPREEQFNSTYRVVSALRIQHQDWTGGKEFKCKVHNEGLPAPIVRTISRTKGPAREPQVYVLAPPQEELSKSTVSLTCMVTSFYPDYIAVEWQRNGQPESEDKYGTTPPQLDADSSYFLYSKLRVDRNSWQEGDTYTCVVMHEALHNHYTQKSTSKSADLLLEEEICADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFKVKWIFSSVVELKRTIVPDYRNMIGQGA
>sp|F1MJK3|F1MJK3_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=LOC506828 PE=4 SV=3
MRGHQLPNPVLILLFLLLPRDASATSKPQYLVLVPSQLYAGVPEKVCVLLNHLNETVALTVTLESETEGRNLLTDLEAKNSFYCSSFTIPDSFPFAFITVQVQGPTQNFIKKKPIYITKAESLVFVQTDKPIYKPGQTVQFRIFSVDVNFHPLNETVSLINPKRNRIFQWPSFKLQGGLSQLSFPLSVEPALGPYKVVLLKEPGKRIEHSFEVDEYVLPKFEVQVKMPKKISFLEDEFEVSVCSLYTYGKPVRGLVTINVCRKYLQYSSSCNGKYPKSICEEFSQQADDEGCFTQLVNAKSLQLKQKGYERTLQVEAKVREEGTGLELTGHGSSEITNTLSKLKFTKVHSHYRRGLPFFGQVLLVNEKDQPIPNETVVVNVDMFQYSARFTTNEHGLVNFSIDTSNFTSSFISVGVIYKQNSHCFDSRWLEESHIPATHTASHIFSPSKSYIQLEPVADTVICGKTQEIRVHYILNGQILTDERELTFYYLIKARGSIAQSETHVLSIKQGELKGVFSFSFRVESDIAPIAQLLVYTILPNGEVIADTEELDIENCFANKVNLSFSSAQGLPASNTSLKITAAPYSLCGLRAVDKSVLLMKPEAEFSPQSVYNLLSVKKIFSMGYRGPMNEDREKCINAEDITHNGIIYIPKQFISDDDAYSIFESVGLNIFTNSKIHKPHFCQPLPYPGMSMNYGGKAPGLASSRSLPGPIHGMATPLAGIDARGVYPSSSREDSSAMKVKETIRKYFPETWIWELIPLDMWGKHELAIKVPDTITEWKASALCLSGTAGLGLSPTISLTAFQPFFLELTLPYSVVRGEAFTLKATVFNYLSHCIRVRALLEASSAFLAIPVEKNEESQCVCGNKQRTVSWAVTPKSLGEVNFTATAEALRSQELCGNKVPHFPEIGQKDTVIKPLLLSLKLPSNVVEGSARATYSVLGDILGSAMQNLQNLLRMPYGCGEQNMVLFTPNIYVLNYLNETGQLTEKIKSKAISYLISGYQRQLNYKHSDGSYSTFGDRDGRSQGNTWLTAFVLKSFSQAQSHIFVEDSHITDSLTWLSRKQKENGCFQRSGSLLNNAIKGGVDDEVTLSAYITIALLEMPLLVTHSIVRNALFCLERAWQSASEAQGSFVYTKALLAYAFALAGDQAKRNELLESLHKEAVKEEDSIHWQRPRKPQEVNELYSPHRAPSVDVEMTSYCLLAHLTAQPAPSSEDLSVATQIVKWLTKQQNPNGGFSSTQDTVVALQALSKYGAATFIKGEKAATVTVKSAGTFSEEFQVDEAKRLLLQEVALPEIPGKYSTAVTGSGCVYIQTSLRYNILPKKEGKAPFTLKVETLPKNCDGVSTHRKVQIHVNISYTGERPSSNMVIVDVKMVSGFIPVKSSVRKLQEMAQIQRTEVSTNHVLIYFEELTHHILSFFFSVEQDIAVKNLKPATIKAYDYYETGESESDMPSLERKKMTNLG
>sp|F1N160|F1N160_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000017305 PE=4 SV=3
GQPKSPPSVTLFPPSKEELSANKATLVCLISDFYPGSVTVAWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKTSACQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEWPWAPTAVPTLVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSECS
>sp|A0A3Q1NEQ0|A0A3Q1NEQ0_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=LOC525947 PE=1 SV=1
MRLVICSLLCAGALGLCLAVPERTVRWCTVSNLEASKCYSFHDNMKKVLSVEGPHVTCVKRTSYLDCIRAIAAHEADAVMVDGGLVYEAGLKPYNLKPVVAEFYGSKDDPQTHHYVVAVVKKGSNFQLNQLQGKKSCHTGLGWSAGWNIPMRMLLPSDWSQEAAAKFFAGSCVPCADQSNFPRLCQLCAGKGMDKCACSHREPYFGYSGAFKCLQDGVGDVSFVRHLTVFENLANQADRDQYELLCRENTRRPVHEYKGCHLARIPSHAVVARSVDGKEDLIWELLSQAQEHFGKDKSAEFQLFYSPHGKDLLFTDAAIGFLRVPPKMDAKLYLGYEYFSVIQHLGRAIPEAEDPQRVMWCTVGHDEHVKCNRWSALSGGILACTVEESTEDCIAAIAKGEADAMSLDGGFIYTAGKCGLVPVLAENYLSQDGKEQLGSKCVNTPMKGYYVVAVVKKSDANLTWNSLRGKKSCHTAVGTSAGWNIPMGFLYNQTGSCKLDEFFSQSCAPGSDPESSLCALCRGSFKPAHMCAPNSHEQYYGSSGALRCLVEKGDVAFVKHPTVLQNTDGKNPEAWAKNLKPEDFQLLCLDGSRKPVTEAQSCHLAIVPSHAVVSRKDKADFVRRMLFNQQELFGRNGFEYMMFQLFKSPAKDLLFSDDTECLANLQDRTTYQKYLGPEYLQAIANVKHCLRSELLDACTFHGN
>sp|A0A3Q1M3A4|A0A3Q1M3A4_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=LOC528040 PE=4 SV=1
MDVPWGLGLLLLLLGIPIAQAEPLYILVTPRVLRIGSPETIHVEAHSDSSEPLSHPLEVNLSVWDFPMKNTRVARRELVLSKENHFMDQASVTIPEDLVYPPKPGMQYVIIEANWAPTSVSSSMNKLVLVAPHAGYIFIQMDKTIYTPEQSVQYRVYTVNHRMDPVSRTFTLDIKNPEGIAVISKDLLPDNGVYIDSFTLPERISIGTWTIEASYQTAPKQKFKTGFEVKEYVLPSFEVQLTPNKTFFYLRDEVLGVNIQARYIFNKPVDGHALAIFGVKQDSRRIPIQSSLQRVEISQGHGHISLQKDTLMAAFQGSEEDFIGASIFVNVTVFSSGGEMVQTEISGVKIVRSPYNIKFIKTPQYFKPGMPFSFRVFVSNPDGSPASKVLVSCTNVKVHTTPRGEATLVINTEANLKELTIQVKTEAPIQPEEQASASMTARPYSTQDESGNFLHIDVKALSTEVGSNLQLNLNTNRDSSVSNKITRFTILVLSKGQIVHAKELKNHGSVFASTIIDVTSKMLPSFRILAFYLLPKGTGQDPELVADSILIDVNDKCQEKLKIGLQNEAYVQPIQPSSLVALKVTGDAEATVGLVAVDKAVHILNSKHKFTQKKIWDTVEEHDIGCTAGSGKDRLAVFKDAGLDMKMSTGMDTLASTDWHCPPSPSPSHRRRRSLKRLETKRKAVNKFKTELEQKCCEAGLRENPVGLSCKERIQHVRHGPVCITAFLSCCQLSETLTREAREEQLLLGTTDEDDDLDDFFLEDEPVRSVFPESWFWKTITLPKTTQGISHYTTHVTMPDSITTWQFVAVSIKTGQGLCVSDPFELTVMKPFFVDLKLPFSVIRNEQVQIQAVLYNFLQQSVKVRVEFPHKESLCSAAKPDAPSRRIVAVPPFSSKVVPFVLLPLEIGKVDVEVKARGSVVQDHVRKTLLVQAGGQIEQISQSFLLNPQGQTKTQLVPKQEFLNKIPNTEADVFVSVQGDILGETILGTLTPSETWRLLRIPSGCPEQTLSSLTPVVILTRYLDSTGQWNKVGVELREQVMKNLARGYSRMLTHRSEDGSYHTSKGNPGSTWLTSYVFRVYALAYPTMTISALSLDSVCNIANWIITHRQRTHGNFVEESPVVMWSMQGGYHGSEADISLTALVLIALNEGKELCSQKIPSLADSMKRAGDFLEKKLPHIRTTFAMAITSYALALIRSPRANDYLDSFASKNKTHWPVGLDDLDLDDSLYTIEATAYALMQKLELGRRNETHAIANWLLKKRQLGGGFQSTQTTVVAIEALTRFREAVPFEGVQDLHIQIKSSKKALHVEWVIDEKNAYQLRSAKFSAEEELQIKASGTGRGTISILTVYHRSPEFLENTCKQYHLNVTLNENQKENKKGEATFQLRMETRFQGHRDATMTIMEISLLTGFYPNQDDLKQLTSEVERYAFQYETKMNSSDSTVVLYLEKLSHKEDTVLGFRVHRMLKAEFLQAAQVTVYDYYEPSRRCTSFYNLPTEHASLRKICDKDVCRCAEEQCPSPKKDSNHLSQEELQTAACEAGVDFVYKASLESVETSDSNPYIYYNMKLQAIIKSGMSKVAEEMVWEPTPGVPKWGQARPMQVNTHWLSSPSGTDSAKPLAVKKFVTHTTCQDSLGLQEHETYLIMGQISDLWRVKSECVAGGLLLPWGLRPGPLSLPQASPWCQNFYCTRQQESWVSGLP
>sp|G3N0S9|G3N0S9_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000047621 PE=4 SV=2
MVCVEQNCPDSVPPLCDLGKVTVLLCCSPPPEVKHGHFVYIQREIWGTDVVEYECQEGYTLVGEARISCRFVGWSPPAPQCKALCQKPEISNGKLSVEKDQYVSPETVTVRCDPGYRMVGSQDILCSENKFWSPDVPKCEKVSAEVCEAVFKGQKLLKCLPNAMEAKVALELHKLSLEIEKLEQEKRKLEIA
>sp|A0A3Q1LPG0|A0A3Q1LPG0_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000050723 PE=1 SV=1
MPEPVTVTWNSGALKSGVHTFPAVRQSSGLYSLSSMVTVPASTSETQTFTCNVAHPASSTKVDKAVTARRPVPTTPKTTIPPGKPTTQESEVEKTPCQCSKCPEPLGGLSVFIFPPKPKDTLTISGTPEVTCVVVDVGQDDPEVQFSWFVDDVEVHTARTKPREEQFNSTYRVVSALRIQHQDWLQGKEFKCKVNNKGLPAPIVRTISRTKGQAREPQVYVLAPPREELSKSTLSLTCLITGFYPEEIDVEWQRNGQPESEDKYHTTAPQLDADGSYFLYSRLRVNKSSWQEGDHYTCAVMHEALRNHYKEKSISRSPGK
>sp|A0A3Q1LRW4|A0A3Q1LRW4_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000047700 PE=1 SV=1
MATQNFERNLLLNLYRKGKNLTLVVCFLLPLEREKKCLTLAAYFLWRLLALLPVPPSVATLGQSLTLCVKERGAPPCVRGAVRGPVSRGLLSHSAPCVSESETSPSIFPLSLGNNDPAGQVVIGCLVQGFFPSAPLSVTWNQNGDSVSVRNFPAVLAGSLYTMSSQLTLPASLCPKGQSVTCQVQHLSKASKTVAVPCIIQDSSSCCVPNCEPSLSVQPPALEDLLLGSNASLTCTLSGLKSAEGASFTWNPTGGKTAVQGSPKRDSCGCYSVSSVLPGCADPWNSGQTFSCSVTHPESKSSLTATIKKDLGNTFRPQVHLLPPPSEELALNELVTLTCLVRGFSPKEVLVRWLQGNQELPREKYLTWGPLPEAGQSVTTFAVTSVLRVDAEVWKQGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMSEVDGVCY
>sp|A0A3Q1M0L5|A0A3Q1M0L5_BOVIN Uncharacterized protein OS=Bos taurus (Bovine) OX=9913 GN=ENSBTAG00000051781 PE=4 SV=1
MRGTARPDCAVAIGRPLGEVVTLRFLEGSLNCSAGEMLLLWGRLVWRKMCGKPAGMVFSSQANTLLVRQRLVRPGGGVLLRYSSQPALGAFHRGCDMQLFGPRGEISSPSMSPDGRNVGGCRIFIDVAPWARIAIHALTVDSGTRAEGTDASYILIRDIHSLRTTAFRGQKTLYWESEGSQAEMEFSQGFLEAHASLRGQYWTLHTRAG
>sp|Q9GKR3|Q9GKR3_BOVIN Vascular cell adhesion molecule-1 7D variant OS=Bos taurus (Bovine) OX=9913 GN=VCAM1 PE=2 SV=1
MLRKMFVIFGASDVLWMVFAVSQASQIDIFPSESKIFAQIGDSVSLTCSTTGCESPSLSWRTQIDSPLNGKVKTEGTTSMLIMDPVSFKDEHQYLCTAICKDKKLEKAIRVEIYSFSKDPEIHLSSPPEVGKPVTVTCSVPDVYPFERLEIELLKGNRPMKVQDFLEPSEKKAQETKSLDVTFSPTDEDIGTALVCQATLHIYDDDSPPKVRKTTKELEVYISPKDTAISVNPSTRLQEGDSVTMTCASAGLPAPRILWSKKLDNGNRQLLSENATLTLISMRAEDSGIYVCEGNNPVGKDRKEVKLTVQEKNFTVEISPGPQIAAQVGDSVVLTCDVRDCESPSFSWRTLIDSPLNGNVRSEGSKSTLTLSPVSFENEHFYLCTVMCGQKKLEKRIQVKPYSFPSNPEIEMSGPLVSGNPVTVSCRVPNVYPSDQLEIELFKGESIMMNKTFSKDVSKKALETKSLEKTFIPTTEDIGNVLVCLARLPIDEMEFELKQRQSTQTLYVNVAPRDTTILVSPSSILEEGSSVNMTCSSNGLPAPKILWSRQLSNGDLQPISENATLSFMSTKMEDSGIYVCEGINQVGTSRKEVNLIIQVAPKDIQLTAFPSERVKEGDTVIISCTCGNVPPTLIILKKKAETGYTVLKSTGGAYTIHRAQLEDAGVYQCESKNEVGSQLRSLTLDVKGRESNKDYFSPELLVLYCASSLIIPAIGMIIYFARRANMTGSYSLVEAQKVC
>sp|A4IFA5|A4IFA5_BOVIN VASN protein OS=Bos taurus (Bovine) OX=9913 GN=VASN PE=2 SV=1
MHSRAPLRLLLPLLLLLPALGPGVQGCPSGCQCNQPRTVFCTARRGTTVPLDVPPDTVGLYIFENGITTLDAGSFAGLPGLQLLDLSQNQIASLPGGVFQPLANLSNLDLTANRLREITNETFRGLRRLERLYLGKNRIRHIQPGAFDVFDRLLELKLQDNELRALPPLRLPRLLLLDLSHNGLSALEPGVLDTANVETLRLAGLGLRHLDEGLFGRLRNLHNLDVADNQLERVPPAVRGLRGLTRLRLAGNTRIAQLWLEDLAGLAALQELDLSNLSLQALPHELSTLFPRLRLLEAARNPFNCVCPLSWFGPWVRESRLTLASPEETRCHFPPKNAGRLLLDLDYSDFGCPATTTTATAPTTRAPVQEPTLPPSSLAPTQLRPTELATEAPSQPPPAPPTAGPVPPPRDCPASICLNGGTCHLGARGHLECLCPQGFTGLYCEGRVRPGPRPSPAPATPRPLPLGIEPASPTSLRVGLQRFQQGSAVQLKSLRLTYRNLSGPDKRPVTLRLPASLAEYTVTQLRPNATYSICVRALGAGRVPEGEEACGEARTPPAVRSNHAPVTQAREGNLPLLIAPALAAVLLAVLAAVGAAFCVRRGRAAAAVVQGKGQVGPGAGPLELEGVKAPLEPDPKALEGGGEAPTGGLECEVPLMGYSGPGPQGPLPAKPYI
>sp|A0A3Q1LXY0|A0A3Q1LXY0_BOVIN Vasopressin-neurophysin 2-copeptin OS=Bos taurus (Bovine) OX=9913 GN=AVP PE=4 SV=1
QLFLKHLKTEGAEKLFFDCSPSTNFGPKESQGDPPPPALLRPPSPARLSPPPHRVSLPGRSPPAPGSSLPSQQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGIGFPRRVRANDRSNATLLDGPSGALLLRLVQLAGAPEPAEP
>sp|F1N789|F1N789_BOVIN Vinculin OS=Bos taurus (Bovine) OX=9913 GN=VCL PE=1 SV=1
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPNASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGASPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLGDLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGRLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMVVDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKPGNPAAKVGISVVAEAEAADAVGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
>sp|A0A3Q1LQ02|A0A3Q1LQ02_BOVIN Vitamin D-binding protein OS=Bos taurus (Bovine) OX=9913 GN=GC PE=4 SV=1
MKRILVFLLAVAFVHALERGKISSAVTICKNFHYMFIFLLRSMVLYSRKFPSGTFEQISHLVNEVVSLTVTCCAEGADPDCYDNRTSALSDKSCESNSPFPVHPGTPECCTHEGLEKKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKDFADRFMYEYSINYGQAPLTLLVGYTKSYLSMVGSCCTSPNPTVCFLKERLQLKHFSLLTIMTNRICSQYAAYGKEKSRLSHLIKFAQKVPTAHLEDVLPLAEDITTILSKCCDSVSEDCIKELPEYAVKLCDNLSTKNSKFKDCCQEKTPMEIFVCAYFMPASPNPELPDVKLPMNKDVCDEGNTKVLDQYIFELSRKTRIPEVFLTKILESTLKSLDECCHSESSTACLNAKGPQLTRELSSFIQKGQELCADYSENTFTEYKKKLAERLRGKFPDATETDLQELVAKRSDFASKCCSVNSPPLYCNSEDSEMNEVELLMDK
>sp|Q3MHN5|Q3MHN5_BOVIN Vitamin D-binding protein OS=Bos taurus (Bovine) OX=9913 GN=GC PE=2 SV=1
MKRILVFLLAVAFVHALERGRDYEKDKVCKDLASLGREDFTSLSMVLYSRKFPSGTFEQISHLVNEVVSLTVTCCAEGADPDCYDNRTSALSDKSCESNSPFPVHPGTPECCTHEGLEKKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKDFADRFMYEYSINYGQAPLTLLVGYTKSYLSMVGSCCTSPNPTVCFLKERLQLKHFSLLTIMTNRICSQYAAYGKEKSRLSHLIKFAQKVPTAHLEDVLPLAEDITTILSKCCDSVSEDCIKELPEYAVKLCDNLSTKNSKFKDCCQEKTPMEIFVCAYFMPASPNPELPDVKLPMNKDVCDEGNTKVLDQYIFELSRKTQIPEVFLTKILESTLKSLDECCHSESSTACLNAKGPQLTRELSSFIQKGQELCADYSENTFTEYKKKLAERLRGKFPDATETDLQELVAKRSDFASKCCSVNSPPLYCNSEIDAEINTLQS
>sp|A0A3Q1M616|A0A3Q1M616_BOVIN Vitamin K-dependent protein C OS=Bos taurus (Bovine) OX=9913 GN=PROC PE=3 SV=1
MWQLTSLLLFVTIWGISSTPAPPDSVFSSSQRAHQVLRIRKRANSFLEELRPGNVERECSEEVCEFEEAREIFQNTEDTMAFWSKYSDGDQCEDRPSGSPCDLPCCGRGKCIDGLGGFRCDCAEGWEGRFCLHEVRFSNCSAENGGCAHYCMEEEGRRHCSCAPGYRLEDDHQLCVSKVTFPCGRLGKRMEKKRKTLKRDTNQVDQKDQLDPRIVDGQEAGWGESPWQAVLLDSKKKLVCGAVLIHVSWVLTVAHCLDSRKKLIVRLGEYDMRRWESWEVDLDIKEVIIHPNYTKSTSDNDIALLRLAKPATLSQTIVPICLPDSGLSERKLTQVGQETVVTGWGYRDETKRNRTFVLSFIKVPVVPYNACVHAMENKISENMLCAGILGDPRDACEGDSGGPMVTFFRGTWFLVGLVSWGEGCGRLYNYGVYTKVSRYLDWIYGHIKAQEAPLESQVP
>sp|P00744|P00744_BOVIN Vitamin K-dependent protein Z OS=Bos taurus (Bovine) OX=9913 GN=PROZ PE=1 SV=1
AGSYLLEELFEGHLEKECWEEICVYEEAREVFEDDETTDEFWRTYMGGSPCASQPCLNNGSCQDSIRGYACTCAPGYEGPNCAFAESECHPLRLDGCQHFCYPGPESYTCSCARGHKLGQDRRSCLPHDRCACGTLGPECCQRPQGSQQNLLPFPWQVKLTNSEGKDFCGGVLIQDNFVLTTATCSLLYANISVKTRSHFRLHVRGVHVHTRFEADTGHNDVALLDLARPVRCPDAGRPVCTADADFADSVLLPQPGVLGGWTLRGREMVPLRLRVTHVEPAECGRALNATVTTRTSCERGAAAGAARWVAGGAVVREHRGAWFLTGLLGAAPPEGPGPLLLIKVPRYALWLRQVTQQPSRASPRGDRGQGRDGEPVPGDRGGRWAPTALPPGPLV
>sp|F1MNM2|F1MNM2_BOVIN Zn_dep_PLPC domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=GPLD1 PE=4 SV=2
MRMGKLAGSGACGPASALFWSGLLMLLGFLCPRSSPCGISTHIEIGHRALEFLHLQDGSINYKELLLRHQDAYQAGSVFPDSFYPSICERGQFHDVSESTHWTPFLNASVHYIRKNYPLPWDEDTEKLVAFLFGITSHMVADVNWHSLGIEQGFLRTMAAIDFHNSYPEAHPAGDFGGDVLSQFEFKFNYLSRHWYVPAEDLLGIYKELYGRVVITKKAIVDCSYLQFLEMYAEMLAISKLYPTYSVKSPFLVEQFQEYFLGGLEDMAFWSTNIYHLTSYMLKNGTSNCNLPENPLFITCGGQQNNTHGSKVQKNGFHKNVTAALTKNIGKHINYTKRGVFFSVDSWTMDSLSFMYKSLERSIREMFIGSSQPLTHVSSPSASYYLSFPYTRLGWAMTSADLNQDGYGDLVVGAPGYSHPGRIHVGRVYLIYGNDLGLPPVDLDLDKEAHEILEGFQPSGRFGSAVAVLDFNVDGVPDLAVGAPSVGSEKLTYTGAVYVYFGSKQGQLSSSPNVTISCQDTYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGSSYSSQEKLNVEAANWMVKGEEDFAWLGYSLHGVNVNNRTLLLAGSPTWKDTSSQGHLFRTRDEKQSPGRVYGYFPPICQSWFTISGDKAMGKLGTSLSSGHVMVNGTRTQVLLVGAPTQDVVSKVSFLTMTLHQGGSTRMYELTPDSQPSLLSTFSGNRRFSRFGGVLHLSDLDNDGSDEIIVAAPLRITDATAGLMGEEDGRVYVFNGKQITVGDVTGKCKSWVTPCPEEKAQYVLISPEAGSRFGSSVITVRSKEKNQVIIAAGRSSLGARLSGVLHIYRLGQD
>sp|F1N726|F1N726_BOVIN ZP domain-containing protein OS=Bos taurus (Bovine) OX=9913 GN=GP2 PE=1 SV=1
MSQLLERMTSVLWLALASYILTLSSTEQQGYRNSTNTGSYEKDLDCGAPGTPEAQLCFDPCQNYTLLNEPFRSTENTEDIQGCDSDKHGWYRFVGDGGVRMPEDCVPTFRCQTSAPLWLNGTHPGLGEGIVNRTACAHWSGNCCLWKTEVLVKACPGPYYVYRLEGTPQCSLRYCTDPATAEDKCDRTCRPEEECRLVSGTWGCFCRQDLNVSDVHSLQPQLDCGDTEIKVSLDKCLLGSLGFGDEVHAYLRDGNWNCSSLRQSEEENWISVTNPTQAGACGNILERNQTHAIYINTLSLVNDFIIRDTILSINFQCAYPLDMKVSLQMALQPIVSSLNITVDGEGEFTVRMALFQDQDYTSPYEGTAVMLSVESMLYVGTILERGDTSRFNLVLKNCYATPTEDKTDPVKYFIIRNSCPNQRDSTISVEENGVSAESRFSVQMFKFAGNYDLVFLHCEVSLCDFIKEECQPSCSRSQLRSEGVAIDPARVLDLGPITRKGAQSLGVMSGTPNTAGFLVAWPLVLLPVLLAGLF